SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSCPOP00000007263 from Cavia porcellus 76_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCPOP00000007263
Domain Number 1 Region: 1054-1102
Classification Level Classification E-value
Superfamily Nuclear receptor coactivator interlocking domain 3.14e-17
Family Nuclear receptor coactivator interlocking domain 0.00011
Further Details:      
 
Domain Number 2 Region: 271-375
Classification Level Classification E-value
Superfamily PYP-like sensor domain (PAS domain) 0.000000000000272
Family PAS domain of steroid receptor coactivator 1A, NCo-A1 0.001
Further Details:      
 
Domain Number 3 Region: 126-191
Classification Level Classification E-value
Superfamily PYP-like sensor domain (PAS domain) 0.000000000000589
Family Hypoxia-inducible factor Hif2a, C-terminal domain 0.044
Further Details:      
 
Domain Number 4 Region: 39-94
Classification Level Classification E-value
Superfamily HLH, helix-loop-helix DNA-binding domain 0.00000916
Family HLH, helix-loop-helix DNA-binding domain 0.0063
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCPOP00000007263   Gene: ENSCPOG00000008077   Transcript: ENSCPOT00000008152
Sequence length 1413
Comment pep:known_by_projection scaffold:cavPor3:scaffold_45:13705103:13735794:1 gene:ENSCPOG00000008077 transcript:ENSCPOT00000008152 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
CIFKMSGLGENSLDPLAPDSRKRKLPCDTPGQGLTCSGEKWRREQESKYIEELAELISAN
LSDIDNFNVKPDKCAILKETVRQIRQIKEQGKAVSNDDDVQKADVSSTGQGVIDKDSLGP
LLLQALDGFLFVVNRDGNIVFVSENVTQYLQYKQEDLVNTSVYSILHEEDRKDFLKNLPK
STVNGVSWTNETQRQKSHTFNCRMLIKTTHDVLEDMNTSQEMRHRYETMQCFALSQPRAM
MEEGEVDLQSCMICVARRITTGERAFPSNPESFITRHDLSGKVVNIDTNSLRSSMRPGFE
DIIRCIQRFFSLNDGQSWSQKRHYQEAYIHGHAETPVYRFSLADGTIVTAQTKSKLFRNP
VTNDRHGFVSTHFLQREQNGYRPNPGPIGQGIRPSASGCSSSVGSMSLSPNQGLQMLSSR
AYSLGDPSTTGQLSGARYGTSSNIASLTAGPGIQSPSSYQNNNYGLNMSSPPHGSPGLGS
NQQNIMISPRNRGSPKMASHQFSPVPDPGVQSPMGSSSSTGSHSFSSSSLSALQAISEGV
GTSLLSTLSSPGPRLDNSPNVNITQASKVISQDAKSPLGLYCDQNPVESTMSNSRDHLND
KESRDSTGEGLENQKGPLESKGHKKLLQLLTCSSDDRGHSSLTNSPLDSSCKDSSVSVTS
PSGVSSSTSGGVSSTSNMHGSLLQEKHRILHKLLQNGNSPAEVAKITAEATGKDTSSAVA
CSEGTVKQEQLSPKKKENNALLRYLLDRDDPSDALCKELQPQVEGTDNKTNMCSSSTIPC
STQEKEPKIKTETNEEPSGNLDNLDAILGDLTSSDFYSNPISTNGSHLGSKQQMFQGPNS
LAGLRSPQSVPSSRPPYSRAVSLDGPVTVGSSPPIKNISSFSMLPKQPMLGGTPRVMDSQ
ENYSSNIGVPNRNVTVSQTPNSGDWGLPNSKASRMEPMSSNSMGRPGGDYSASLPCSLPR
PSMAGAMSTFPLRSNNIPGARPCLFENLTLFLFAPPEPGEIPMGMGVNHYAQATPPNQPG
SWPDAMLSMEQIPHGTQNRPILRNSLDDLLGSPSNLEGQSDERALLDQLHTLLSNTDATG
LEEIDRALGIPELVNQGQTLEPKQDPFQGQETAVMMDQKAALYGQTYSTQGPPIQGGFNL
QGQSPSFNSMMNQISQQSSFPLQGMHPRASIMRPRTNTPKQLRMQLQQRLQGQQFLNQSR
QALEMKIENPAGGGAAAMRPMMQPQVSSQQGFLNAQMVAQRSRELLSHHFRQQRMAMMLP
PPPQQSQAFSPPPNVTASPSMDGVLAGPAMPQAQPQQFPYPPNYGLGQQPDPAFGRVPSP
PNPMMSSRMGPSQNPMMQHPQTAPMYQSSEMKGWPSGNLARNSSFPQQQFAHQGNPAAYS
MVHMNGSSGHLGQMNMNSMSMSGMPMGPDQKYC
Download sequence
Identical sequences 10141.ENSCPOP00000007263 ENSCPOP00000007263 ENSCPOP00000007263

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]