SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSCPOP00000007423 from Cavia porcellus 76_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCPOP00000007423
Domain Number 1 Region: 63-331
Classification Level Classification E-value
Superfamily Radical SAM enzymes 3.14e-68
Family MoCo biosynthesis proteins 0.00000401
Further Details:      
 
Domain Number 2 Region: 487-631
Classification Level Classification E-value
Superfamily Molybdenum cofactor biosynthesis protein C, MoaC 1.7e-51
Family Molybdenum cofactor biosynthesis protein C, MoaC 0.0000128
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCPOP00000007423   Gene: ENSCPOG00000008257   Transcript: ENSCPOT00000008332
Sequence length 634
Comment pep:known_by_projection scaffold:cavPor3:scaffold_15:33503631:33530997:1 gene:ENSCPOG00000008257 transcript:ENSCPOT00000008332 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAAQPLFRMIRRLLRSSVRGCSSGAPVTQPSPREPSRPATEELSRQRWQFLREHTAPFSA
FLTDSFGRQHSYLRISLTEKCNLRCQYCMPEEGVPLTPKADLLTTEEILTLARLFVKEGV
DKIRLTGGEPLIRRDVVDIVAQLHQLEGLKTIGVTTNGINLARLLPSLQKAGLGAINISL
DTLVPAKYEFIVRRKACMAGPANGLELGYDPVKVNCVVMRGLNEDELLDFVALTKDLPLD
VRFIEYMPFDGNKWNFKKMVSYKEMLDTIRQQWPALEKLPEEDLSTAKAFRIPGFQGQIS
FITSMSEHFCGTCNRLRITADGNLKVCLFGNSEVSLRDHLRAGASEEELLTIIGAAVGRK
KRQHAAGMFNIAQMKNRPMILIGLFLTCQDSPPASPVTSSWRPVPAQDQRPRLLLSRLMA
TWWKTKTPQVPPLAWQWLGAGSPLRLYSSQADSDTTSMCLSPGTRAHATTSGPWAASDQL
THVDSEGRAAMVDVGRKPDTDREAVASGVVLLGPVAFELVQQNQLKKGDALGVAQLAGVQ
AAKLTSQLIPLCHHVALSHIQVQLRLDPERHAVVIQASCRARGPTGVEMEALTSAAVTAL
TLYDMCKAVSRDIEIGEIKLISKTGGQRGDFRRA
Download sequence
Identical sequences 10141.ENSCPOP00000007423 ENSCPOP00000007423 ENSCPOP00000007423

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]