SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSCPOP00000007547 from Cavia porcellus 76_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCPOP00000007547
Domain Number 1 Region: 369-499
Classification Level Classification E-value
Superfamily C-type lectin-like 8.22e-34
Family C-type lectin domain 0.00099
Further Details:      
 
Domain Number 2 Region: 169-352
Classification Level Classification E-value
Superfamily C-type lectin-like 2.8e-29
Family C-type lectin domain 0.001
Further Details:      
 
Domain Number 3 Region: 1112-1231
Classification Level Classification E-value
Superfamily C-type lectin-like 4.07e-29
Family C-type lectin domain 0.0021
Further Details:      
 
Domain Number 4 Region: 1227-1375
Classification Level Classification E-value
Superfamily C-type lectin-like 1.03e-28
Family C-type lectin domain 0.0023
Further Details:      
 
Domain Number 5 Region: 949-1096
Classification Level Classification E-value
Superfamily C-type lectin-like 6.82e-28
Family C-type lectin domain 0.0011
Further Details:      
 
Domain Number 6 Region: 804-934
Classification Level Classification E-value
Superfamily C-type lectin-like 4.02e-27
Family C-type lectin domain 0.0013
Further Details:      
 
Domain Number 7 Region: 654-795
Classification Level Classification E-value
Superfamily C-type lectin-like 4.89e-27
Family C-type lectin domain 0.0016
Further Details:      
 
Domain Number 8 Region: 32-156
Classification Level Classification E-value
Superfamily Ricin B-like lectins 9.86e-24
Family Cysteine rich domain 0.022
Further Details:      
 
Domain Number 9 Region: 504-641
Classification Level Classification E-value
Superfamily C-type lectin-like 2.97e-21
Family C-type lectin domain 0.0018
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCPOP00000007547   Gene: ENSCPOG00000008394   Transcript: ENSCPOT00000008469
Sequence length 1458
Comment pep:known_by_projection scaffold:cavPor3:scaffold_3:28578503:28689184:1 gene:ENSCPOG00000008394 transcript:ENSCPOT00000008469 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
IPWLGLSSVPAGKSPKSLLPALGGNLKVTDKKGIFIIQSESLKKCIQVGPSVLTLEDCKQ
PNENMLWKWVSYHRLFNLGGSGCLGLNLSNPEQPLGIYECDSTDVSLRWHCSRKMIVGPL
QYMVQVEHDNTVMASWKHLHKWVSYMSGGGDICEHLHTDLYTIKGNGHGLPCVFPFQYRH
QWHHECIREGREDNLLWCATTSRYERDEKWGFCPDPTSTKVACDTVWEKDPNTHICYQFN
LHSFLSWNEAHSSCQLQGGDLLSIEDENEENFIKKHMSNETVEVWIGLNQLDQNAGWQWS
DGLPLSYLNLYPEIHFEPFVEYHCGTFHSFMPTAWRSRDCESTFPYVCKKYLSHHTGHET
AENDAWKYHATHCEAGWKPYNRNCYKLQKEAKTWNEALRSCQSGNSTLIDIASLAEVEFL
VNLLGAENASETWIGLSSNKIPVSFEWSNGSPVVFTNWNTLEPQIFPSRSQLCVSAEHPE
GHWKVKNCEETLFYTCKKAGRVLSDTDSGCQKGWERHDRFCYKVDPVLRSFDHASSGYYC
PPALITITNRFEQAFITSLISNVVKMKNHYFWIALQDQNDTGEYTWKTAGQESELVQYTY
WNAHEPRYSGGCVAVRGSSPVGRWEVKDCAHFKAMSLCKQPVEKRKKTEHEERWPFHPCH
LEWESKPGLASCFKVFHSEKVLTKRTWREAEAFCEEFGAHLASFAHIEEENFVNELLHSK
FNRTEERQFWIGFNKRNPLSMGSWEWSDGTPVVSSFLDNNYFGEEARNCAVFKAKKTLLP
SHCDFKHEWICKIPRDVRPNIPSWYQYDAPWLFYQDAEYLFYTHDSEWASFEFVCGWLRG
DLLTIHSAHEQEFIHSKIKLLSKYGVNWWIGLQEEKANNEFHWTDGSPLIYQNWDNRREI
SMNNQSQTCGFISSKTGLWGSEECSVFMPGICKRKKIWVIEKENNTPKQHGTCPNGWLYF
NYKCLLVVVPKDPSNLKNWTGALDFCVAKGGTLVAIESEVEQAFITMNLFGHTTNVWIGL
QIDDYEKWLNGKPVIYSNWSPFDIVNVPNYHTTDVHKHTSLCALLSSNPNFHFTGKWYLE
DCGKESYGFVCEKMQDTSGPRVNASDMYPVPNTLEYGDRTYKIINANMTWYAAIRTCIMH
GAELVSIADQYHQSFLTVILNRLGYDHWIGLFTTDNGRNFGWSDGTKSSFTFWKDEESSF
SGDCVFADTNGRWHSTACESFLQGAICYVPSEIKLFGHPMCSETSIPWVKFKSNCYSFST
LLDHMSFEAAHEFCKKEGSNLLTIKDEDENLFLLEELLVFDSIVQMVWLNAQLDSNNETI
KWFDGTPTDQSNWGIRKPDLEPLKSHQCIALRIPDGVWQLSPCQDKKGFICKMEADIGIE
KELPGKEPSHSTVPLAIALTLTVILVISTLSFYIYKRNSNFFQRLTGLGNPYYPTTNLST
VHLEEENIVISDLEKNDQ
Download sequence
Identical sequences ENSCPOP00000007547 10141.ENSCPOP00000007547 ENSCPOP00000007547

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]