SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSCPOP00000007592 from Cavia porcellus 76_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCPOP00000007592
Domain Number 1 Region: 16-129
Classification Level Classification E-value
Superfamily Kringle-like 1.81e-27
Family Kringle modules 0.00094
Further Details:      
 
Domain Number 2 Region: 216-323
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 9.16e-21
Family Spermadhesin, CUB domain 0.0016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCPOP00000007592   Gene: ENSCPOG00000008444   Transcript: ENSCPOT00000008521
Sequence length 466
Comment pep:known_by_projection scaffold:cavPor3:scaffold_4:22983129:22986629:1 gene:ENSCPOG00000008444 transcript:ENSCPOT00000008521 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGTRALLGLLLFIPLLQPRRAWAGSLKSPGLSECFQVNGADYRGHQNHTGPRGTGRPCLF
WDQTQQHSYSSASDPQGRWGLGAHNFCRNPDGDVQPWCYVAETEEGIYWRYCDIPTCHMP
GYLGCFVDSGTPPALSGPSGTSTKLTVQVCLRFCRMKGYQLAGVEAGYACFCGSESDLAR
GRGAPATDCDQICFGHPGQLCGGDGRLGIYEVSVGSCQGNWTAPQGVIYSPDFPDEYGPD
RNCSWVVGPSSGAALELTFRLFELADPRDRLELREVPSGSLLRAFDGTRPPPAGPLRLRV
AAVLLTFHSDARGHAQGFALTYRGGSAGLQNIVEDRAQPKGSAQTPEETPGRANASCSPR
PVTLQAAMGARVFSLATVVSVLLFLLLSLLLHLLRRRNCLLAPGKGPPTLGPSRDTGRSW
TVWYRRPRRMALPCPTGDPQAESPAAGYRPLSASSQSSLRSLISAL
Download sequence
Identical sequences ENSCPOP00000007592 10141.ENSCPOP00000007592 ENSCPOP00000007592

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]