SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSCPOP00000007619 from Cavia porcellus 76_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCPOP00000007619
Domain Number 1 Region: 44-283
Classification Level Classification E-value
Superfamily PLP-binding barrel 1.57e-72
Family Alanine racemase-like, N-terminal domain 0.000000000864
Further Details:      
 
Domain Number 2 Region: 264-414
Classification Level Classification E-value
Superfamily Alanine racemase C-terminal domain-like 1.11e-47
Family Eukaryotic ODC-like 0.000000494
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCPOP00000007619   Gene: ENSCPOG00000008476   Transcript: ENSCPOT00000008553
Sequence length 462
Comment pep:known_by_projection scaffold:cavPor3:scaffold_125:3256624:3260318:1 gene:ENSCPOG00000008476 transcript:ENSCPOT00000008553 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MNSARSEEFDCCFLDEGFTAKDILDQKINEVSSSDDKDAFYVADLGDVLKKHLRWRKALP
RVTPFYAVKCNDSRAIVKTLAAIGTGFDCASKTEIQLVQSLGVPPERIIYANPCKQVSQI
KYAASSGVQMMTFDSEVELLKVARAHPKAKLVLRIATDDSKAVCRLSVKFGATLKTSRLL
LERAKELNIDVIGVSFHVGSGCTDPETFVQAVSDARCVFDMGAEVGFHMHLLDIGGGFPG
SEDTKLKFEEITSVINPALDKYFPVDSGVRIIAEPGRYYVASAFTLAVNIIAKKLVLREQ
AGSDDEEDASEQTFMYYVNDGVYGSFNCILYDHAHVKPLLQKRPKPDERHYPSSIWGPTC
DGLDRIVERCALPELHVGDWLLFENMGAYTVAAASTFNGFQRPTIHYVMSQPMWWQLVQR
LRNTSFPPGVEEQDVGALPVPCAWESEMKGHTAARTSASINA
Download sequence
Identical sequences ENSCPOP00000007619 ENSCPOP00000007619 10141.ENSCPOP00000007619

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]