SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSCPOP00000007935 from Cavia porcellus 76_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCPOP00000007935
Domain Number 1 Region: 1922-2086
Classification Level Classification E-value
Superfamily C-type lectin-like 1.24e-43
Family C-type lectin domain 0.000000321
Further Details:      
 
Domain Number 2 Region: 480-586
Classification Level Classification E-value
Superfamily C-type lectin-like 2.02e-41
Family Link domain 0.0013
Further Details:      
 
Domain Number 3 Region: 152-261
Classification Level Classification E-value
Superfamily C-type lectin-like 7.53e-40
Family Link domain 0.0015
Further Details:      
 
Domain Number 4 Region: 590-703
Classification Level Classification E-value
Superfamily C-type lectin-like 1.4e-29
Family Link domain 0.0037
Further Details:      
 
Domain Number 5 Region: 262-356
Classification Level Classification E-value
Superfamily C-type lectin-like 6.52e-28
Family Link domain 0.0025
Further Details:      
 
Domain Number 6 Region: 34-152
Classification Level Classification E-value
Superfamily Immunoglobulin 0.0000000000000783
Family V set domains (antibody variable domain-like) 0.035
Further Details:      
 
Domain Number 7 Region: 2086-2144
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.0000000000082
Family Complement control module/SCR domain 0.0025
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCPOP00000007935   Gene: ENSCPOG00000008837   Transcript: ENSCPOT00000008916
Sequence length 2168
Comment pep:known scaffold:cavPor3:scaffold_10:35026088:35060385:-1 gene:ENSCPOG00000008837 transcript:ENSCPOT00000008916 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MTTLFFVFVTLRVITAAILEEASADHDNALSVSIPQPSPLKVLLGTSVTIPCYFIDPMHP
VTTAPSTAPLSPRIKWSRISKEKEVVLLVATEGRVRVNSAYQDRVSLPSYPAIPSDATLE
IQHLRSNDSGIYRCEVMHGLEDSEATLEVLVKGIVFHYRAISTRYTLDFDRAQRACLQNS
AIIATPEQLQAAYEDGFHQCDAGWLADQTVRYPIHTPREGCYGDKDEFPGVRTYGIRDTN
ETYDVYCFAEEMEGEVFYATSPEKFTFQEAASECRRLGARLATTGQLYLAWQGGMDMCSA
GWLADRSVRYPISKARPNCGGNLLGVRTVYLHANQTGYPDPSSRYDAICYTGEDFVDIPE
NFFSVGGEEDITIQTVTWPDMELPLPRNITEGEARGNVIHTVKPDFEVSPTDLEPEKSFT
FAPDMEVTAFPEAENGTEEITKPWGFPEESRPTSFTSEDLVVPVTIAPGAAEVPGQLGGV
VFHYRPGSTRYSLTFEQAQQACLSAGAVMASPEQLQAAYEAGYEQCDAGWLQDQTVRYPI
VSPRTPCVGDKDSSPGVRSYGIRPSSETYDVYCYVDKLEGEVFFTTRPEQFTFHEALAFC
ESQNASLATTGQLYAAWVRGLDKCYAGWLADGTLRYPIVTPRPACGGDKPGVRTVYLYPN
QTGLPDPLSRHHAFCFQGVPGVPSPGEEESGTPTPQAGLEDWIITRAVPGVAVIPLREET
TAVLDFTTGPENQTEWEPVYTTMGLSPLPAMAPALTPAQCAAETTLTTVTGTALLVKHTR
TFSLVPSFLLHTHPSPGPSRDPQSHCPAQKPSPVGGSPKRSRARKGGAVKNPNLSPCPSL
FHDPPLTQACQNFLGNTELNQCTVVCVPGSISSWKHMHGKVVSAIPTSPSRHSFHSWLPS
RVLGLQSLSLSRWDPSLRPHPATSAHGPFLSLARARATESCEPGGGKAWHRRTLATSGGV
LPSGTVLQCASLTSVLVSATDRELSDYDCKWPGSLFLMHMLKCIAMLLWTPLNSCSYMVT
LPSPSPPTVLRRDPELTNLFSTPVCLDISAKRKGNGGGSEMGRSHLPAHMKDLDARDGNV
LEGGLRLSSVAAPCPLVCGPEGTGGNPPFLPSSPLQQFHCEASEHGCTLGGKVSAGLPTG
VPSLWPPTGTAAEESTEGPGGTAVPSAWEAPSFSQEPYTPSPAMPSATELPDFQEASEAP
DVSGAFTDSGEAPGATASGLPSGDLDSSVLTPTVVSSLPPGYEDRIEWSSIPTIEVLPTG
AEDLESSAPGVWDGSDLVGSASGDLAFGQLPSETVGSGQAPDTSGLPSGFSGEYSGVDFG
SAPSSGLPDFSGLPSGFPTVSLVDSTLVEVVTATSASELEGRGTIGISGTGEASGLPFDD
LDISGRTSGLSSGVTELSELPSGQPDVSGEASGVLFGSGQPFGITDLSGETSTGPDLSGQ
SSGLPEVSGTTPGILDLVSGTMSGSGESSGITFVDTSVMQVTPTTFKEEEGLGSVEFSGF
PSGETDLSGTSGGVDISEQSSGTIDSSGFTSPAPELSGLPSGVAEVSGDFSGAEAGSSLP
SGAYDGSGLPSGFPTISLVDRTLVESVTQSPTAQEAGEGSSGILELSGASSGAPEVSGDQ
SGFLDQSGLQSGLVEPSREPPSTPYFSGDFSSTADVSGESSAATSSSGETSGLPEVTLIT
SELVEGVTEATVSQELGQRPPMTYTPQLFEASGEASGSGDISGATSTFPGPGVEASSVPE
GSSESSAYPEAGVRASAVPVASGEVSGSPDSSETTSALHEADLDQASGLGVSSRPWTFLG
GPQEGSAAPEVNEKSITTSQVDIEASSPPLATAVASGDRTETSGELSVHSPGLDVTISTG
APETQWTQHPAEVHLEVESSSPLYSGEETHTAETATFPTDATAPTSSEGSGEAETSMADI
DECLSSPCLNGATCVDTMDSFTCLCLPSYGGDLCEIDQEVCEEGWTKFQGHCYRHFPDQE
TWVDAERRCREHQSHLSSIITPEEQEFVNRNAQDYQWVGLNDRTIEGDFRWSDGHPLQFE
KWRPNQPDNFFTTGEDCVVMIWHEKGEWNDVPCNYHLPFTCKKGTVACKDPPMVEHARTL
GHRKDRYEINSLVRYQCTEGFVQRHIPTIRCQPSGHWEEPRITCTDPTTYKRRLQKRSSR
QSRQHLGH
Download sequence
Identical sequences ENSCPOP00000007935 ENSCPOP00000017681 10141.ENSCPOP00000007935

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]