SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSCPOP00000008297 from Cavia porcellus 76_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCPOP00000008297
Domain Number 1 Region: 127-255
Classification Level Classification E-value
Superfamily DNA clamp 1.86e-47
Family DNA polymerase processivity factor 0.000000371
Further Details:      
 
Domain Number 2 Region: 1-126
Classification Level Classification E-value
Superfamily DNA clamp 3.43e-42
Family DNA polymerase processivity factor 0.000000577
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCPOP00000008297   Gene: ENSCPOG00000009242   Transcript: ENSCPOT00000009327
Sequence length 261
Comment pep:known_by_projection scaffold:cavPor3:scaffold_8:19781971:19785334:1 gene:ENSCPOG00000009242 transcript:ENSCPOT00000009327 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MFEARLVQGSILKKVLEALKDLINEACWDISSGGVNLQSMDSSHVSLVQLTLRSEGFDTY
RCDRNLAMGVNLTSMSKILKCAGNEDIITLRAEDNADTLALVFEAPNQEKVSDYEMKLMD
LDVEQLGIPEQEYSCVVKMPSGEFARICRDLSHIGDAVVISCAKDGVKFSASGELGNGNI
KLSQTSNVDKEEEAVTIEMNEPVQLTFALRYLNFFTKATPLSPTVTLSMSADVPLVVEYK
ISDMGHLKYYLAPKIEDEEGS
Download sequence
Identical sequences H0VE65
10141.ENSCPOP00000008297 ENSCPOP00000008297 XP_003476647.1.53824 XP_006984048.1.50099 ENSCPOP00000008297

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]