SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSCPOP00000008337 from Cavia porcellus 76_3

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  ENSCPOP00000008337
Domain Number - Region: 168-277
Classification Level Classification E-value
Superfamily Tubby C-terminal domain-like 0.00228
Family At5g01750-like 0.067
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCPOP00000008337   Gene: ENSCPOG00000009287   Transcript: ENSCPOT00000009372
Sequence length 291
Comment pep:known_by_projection scaffold:cavPor3:scaffold_61:9252238:9256106:1 gene:ENSCPOG00000009287 transcript:ENSCPOT00000009372 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
PTGYLPPKGYAPSPPPPYPVTTGYAEPAQHPGPGQPSVPAQVPPPAPGFAVFPSPGPASV
PFLPLPGVPSGLEFLAQIDQILIHQKTEPVETFLGWETCNRYELRSGAGQPLGQAAEESN
CCARLCCGSQRPLRVRMADPGDREVLRLIRPLHCGCLCCPCGLQEMEVQSPPGTTIGHVL
QTWHPFLPKFSIQDADRQTVLRVVGPCWTCGCGTDTNFEVKTRDESRSVGRISKQWGGLL
REALTDADDFGLQFPLDLDVRVKAVLLGATFLIDYMFFEKRGGAGPSAITG
Download sequence
Identical sequences ENSCPOP00000008337 10141.ENSCPOP00000008337 ENSCPOP00000008337

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]