SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSCPOP00000008338 from Cavia porcellus 76_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCPOP00000008338
Domain Number 1 Region: 155-273
Classification Level Classification E-value
Superfamily DNA clamp 3.1e-16
Family DNA polymerase processivity factor 0.022
Further Details:      
 
Weak hits

Sequence:  ENSCPOP00000008338
Domain Number - Region: 23-101
Classification Level Classification E-value
Superfamily DNA clamp 0.00229
Family DNA polymerase processivity factor 0.037
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCPOP00000008338   Gene: ENSCPOG00000009289   Transcript: ENSCPOT00000009374
Sequence length 282
Comment pep:known_by_projection scaffold:cavPor3:scaffold_29:21126277:21131570:1 gene:ENSCPOG00000009289 transcript:ENSCPOT00000009374 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MPLLTQHVRDENRQYCLVASLDNVRNFSTVLKAIHFQEHATCFATKNGIKVTVENAKCVQ
ANAFIQAEVFQEFRVEEESVIFRINLTILLDCLSIFGSNPMPGTFTALRMCYQGHGQPLM
LFLEEGGVVTVCKINTQEPVGTLDFDFCSTNVISKIILQSEGLREAFSELDMTSEILQMT
ISPDRPYFRLSTFGNAGSSHLDYPKDCDLMESFHCNHTQVNRYKLSLLKPSTKALVLSCK
VSIRTDNRGFLSLQYMIKNEDGQISFVDYYCCPDEDIPESES
Download sequence
Identical sequences A0A286XDE7
10141.ENSCPOP00000008338 XP_003470270.1.53824 XP_013008333.1.53824 XP_013008334.1.53824 XP_013008335.1.53824 ENSCPOP00000008338 ENSCPOP00000008338

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]