SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSCPOP00000008482 from Cavia porcellus 76_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCPOP00000008482
Domain Number 1 Region: 161-268
Classification Level Classification E-value
Superfamily C-type lectin-like 2.91e-40
Family Link domain 0.002
Further Details:      
 
Domain Number 2 Region: 273-355
Classification Level Classification E-value
Superfamily C-type lectin-like 4.72e-26
Family Link domain 0.0015
Further Details:      
 
Domain Number 3 Region: 48-160
Classification Level Classification E-value
Superfamily Immunoglobulin 0.00000000000000128
Family V set domains (antibody variable domain-like) 0.0079
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCPOP00000008482   Gene: ENSCPOG00000009448   Transcript: ENSCPOT00000009533
Sequence length 357
Comment pep:known_by_projection scaffold:cavPor3:scaffold_10:35017609:35021912:1 gene:ENSCPOG00000009448 transcript:ENSCPOT00000009533 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
VGLLLPVLLLTLPCAPGLPFYNGFYYSPGGRDLGSDHRESLFNGVKLVVETPEETLFTHW
GANVTLPCRYHYEPALASPRPVRIKWWKLSENGAPEQDVLVTIGQRRRSFGDYEGRVHLR
QDQEREASLELRDLRPEDSGRYRCEVIDGLEDESGVVELELRGVVFPYQPRQGRYQLNFH
EAQQACEEQGAVVASFEQLFRAWEEGLDWCNAGWLQDGSVQYPITLPREPCGGLGLAPGM
RSYGLRHRRLHRYDVFCFTAALKGQVYYLEHPEKLTLAEAREACREDGAHIAKVGQLFAA
WKFRGLDRCDAGWLADGSARYPVAHSRPNCGPPEPGVRSFGFPDPQSRHGVYCHRQR
Download sequence
Identical sequences 10141.ENSCPOP00000008482 ENSCPOP00000008482 ENSCPOP00000008482

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]