SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSCPOP00000008688 from Cavia porcellus 76_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCPOP00000008688
Domain Number 1 Region: 158-303
Classification Level Classification E-value
Superfamily C-type lectin-like 9.97e-42
Family C-type lectin domain 0.00000384
Further Details:      
 
Weak hits

Sequence:  ENSCPOP00000008688
Domain Number - Region: 82-175
Classification Level Classification E-value
Superfamily Myosin rod fragments 0.00915
Family Myosin rod fragments 0.024
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCPOP00000008688   Gene: ENSCPOG00000009682   Transcript: ENSCPOT00000009769
Sequence length 305
Comment pep:novel scaffold:cavPor3:scaffold_61:9497511:9500073:1 gene:ENSCPOG00000009682 transcript:ENSCPOT00000009769 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MDPDYENLQKFGSEMKNSGIRKAAPLQSALGNCCRGPYLAQISLGLSLLLLVAVCVIGHQ
GSNLRRDLVTLSTNFSNSSSHHEVNIQQLTSNCGALQNAIKSLKAEVEDHGEELQAGRSL
SQKVTSLESTLQQKEAAFKADQSQILLRIQELVKELRSLSCELAYFKSNGEEEETCCPLN
WIAHEGSCYWFSQSKKPWDEANKHCQMENAHLVMVNSLGEQIFIQSNTRSINTWMGLTDR
SGSWKWVDGSDLDPGFKNWSPEQPDNWSGHEMGGGEDCAHFNSDGSWNDNVCKRAFHWIC
ETEQS
Download sequence
Identical sequences ENSCPOP00000008688 10141.ENSCPOP00000008688 ENSCPOP00000008688

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]