SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSCPOP00000008855 from Cavia porcellus 76_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCPOP00000008855
Domain Number 1 Region: 361-594
Classification Level Classification E-value
Superfamily HCP-like 3.92e-48
Family HCP-like 0.00017
Further Details:      
 
Domain Number 2 Region: 568-702
Classification Level Classification E-value
Superfamily HCP-like 1.01e-26
Family HCP-like 0.0059
Further Details:      
 
Domain Number 3 Region: 201-325
Classification Level Classification E-value
Superfamily HCP-like 5.58e-26
Family HCP-like 0.0029
Further Details:      
 
Domain Number 4 Region: 119-172
Classification Level Classification E-value
Superfamily Kringle-like 3.43e-20
Family Fibronectin type II module 0.00085
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCPOP00000008855   Gene: ENSCPOG00000009870   Transcript: ENSCPOT00000009959
Sequence length 796
Comment pep:known_by_projection scaffold:cavPor3:scaffold_20:24968367:25013359:-1 gene:ENSCPOG00000009870 transcript:ENSCPOT00000009959 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
ENRMQVRVGLTLLLCAVLLSSGSASSDEEDNQEESSDSKSSLPPDESVKDHTITGKVVAG
QIFVDSEESELESPIHEEKDSFKSQEGEGATEEISFLESPDSEKDYEEPKKVRKPVLTAI
EGTAHGEPCHFPFLFLDKEYDECTSDGREDGRLWCATTYDYKTDEKWGFCETEEEAAKRR
QMQEAEMLYQTGMKILNGSNKKSQIREAYRYLQKAASMNHTKALERVSYALLFGYYLPQN
IQAAKEMFEKLTEEGSPKGQTALGFLYASGLGVNSSQAKALVYYTFGALGGNLIAHMVLG
YRYWAGIGVLQSCESALTHYRLVANHVASDISLTGGSVVQRIRLPDEVENPGMNSGMLEE
DLIQYYQFLAEKGDVQAQVGLGQLHLHGGRGVEQNHQRAFDYFNLAANAGNSHAMAFLGK
MYSEGSDIVPQSNETALHYFKKAADMGNPVGQSGLGMAYLYGRGVQVNYDLALKYFQKAA
EQGWVDGQLQLGSMYYNGIGVKRDYKQALKYFNLASQGGHILAFYNLAQMHASGTGVMRS
CHTAVELFKNVCERGRWSERLMSAYNSYKDGDYNAAVIQYLLLAEQGYEVAQSNAAFILD
QREATIVGENETYPRALLHWNRAASQGYTVARIKLGDYHFYGFGTDVDYETAFIHYRLAS
EQQHSAQAMFNLGYMHEKGLGIKQDIHLAKRFYDMAAEASPDAQVPVFLALCKLGVVYFL
QYIRETNIRDLFTQLDLDQLLGPEWDLYLMTIIALLLGTVIAYRQRQHQELPMPRPPGPR
PAPPQPEGPPEQQLPQ
Download sequence
Identical sequences ENSCPOP00000008855 10141.ENSCPOP00000008855 ENSCPOP00000008855

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]