SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSCPOP00000009000 from Cavia porcellus 76_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCPOP00000009000
Domain Number 1 Region: 561-817
Classification Level Classification E-value
Superfamily Trypsin-like serine proteases 5.83e-81
Family Eukaryotic proteases 0.00012
Further Details:      
 
Domain Number 2 Region: 441-542
Classification Level Classification E-value
Superfamily SRCR-like 1.57e-39
Family Scavenger receptor cysteine-rich (SRCR) domain 0.0000762
Further Details:      
 
Domain Number 3 Region: 222-325
Classification Level Classification E-value
Superfamily SRCR-like 4.84e-39
Family Scavenger receptor cysteine-rich (SRCR) domain 0.0000603
Further Details:      
 
Domain Number 4 Region: 330-431
Classification Level Classification E-value
Superfamily SRCR-like 4.84e-34
Family Scavenger receptor cysteine-rich (SRCR) domain 0.00012
Further Details:      
 
Domain Number 5 Region: 39-108
Classification Level Classification E-value
Superfamily Kringle-like 0.0000000000029
Family Kringle modules 0.0088
Further Details:      
 
Domain Number 6 Region: 111-211
Classification Level Classification E-value
Superfamily SRCR-like 0.00000123
Family Scavenger receptor cysteine-rich (SRCR) domain 0.014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCPOP00000009000   Gene: ENSCPOG00000010027   Transcript: ENSCPOT00000010118
Sequence length 818
Comment pep:known_by_projection scaffold:cavPor3:scaffold_7:561932:627199:-1 gene:ENSCPOG00000010027 transcript:ENSCPOT00000010118 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
RPPAARLGQAPATLRARSAARSLCRGRTPMGCPAGQLRVNVTDLGAPCLRWAEVPPFLER
SPPTGWAQLRGQRHNFCWGPDGSSRPWCFYSNARGQVDWGYCACRPGEVKNCGGKKEFEG
SMEVFYCINKVYYFSCHSHWEDKSSMIKSHTNSFSGLTLKTKFWFDVLNSLKHYLSNVCC
HGDEENIFLCEKDIWQGGVCLVKMVAAVMCSFPKQGPSLPVIRLAGGSSMHEGRVELYHA
GQWGTICDDQWDDADAEVICRQLGLISGIAKAWNQAYFGEGSGPILLDEVHCTGNELSIE
QCPKSSWGEHNCNHKEDAGVSCTPLTDGVIRLAGGKGSHEGRLEVYYRGQWGTVCDDGWT
ELNTYVACRLLGFKYGKQASPDHFEESPGPIGLDDVSCSGKETSLLQCSRRQWGKHDCSH
REDVGITCHPGSDGHKPSLGFPIRLMDGENKKEGRVEVFVNGQWGTICDDGWTDKDAAVI
CRQLGYKGPAKARTMAYFGEGKGPIHMDNVECTGSERSVADCIKQDIGRHNCRHSEDAGV
ICDYFSKKASSNSNKESLSSVCGLRLLHRRQKRIIGGKNSLRGGWPWQVSLRLKSSHGDG
RLLCGATLLSSCWVLTAAHCFKRYGNSTRNYVIRVGDYHTLVPEEFEEEIGVQLIVIHQK
YRPVSNDYDIALVRLQGPEEQCARFSSHVLPACLPLRRERPQKTASNCYVTGWGDTGRAY
SRTLQQAAIPLLPKRFCEDRYKGRFTGRMLCAGNLQEHKRMDSCQGDSGGPLMCERPGET
WVVYGVTSWGYGCGAKDSPGVYTKVSAFVPWIKSVTKL
Download sequence
Identical sequences ENSCPOP00000009000 ENSCPOP00000009000 10141.ENSCPOP00000009000

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]