SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSCPOP00000009023 from Cavia porcellus 76_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCPOP00000009023
Domain Number 1 Region: 22-174
Classification Level Classification E-value
Superfamily Glyoxalase/Bleomycin resistance protein/Dihydroxybiphenyl dioxygenase 1.1e-34
Family Glyoxalase I (lactoylglutathione lyase) 0.000000145
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCPOP00000009023   Gene: ENSCPOG00000010050   Transcript: ENSCPOT00000010141
Sequence length 180
Comment pep:known_by_projection scaffold:cavPor3:scaffold_15:35462937:35481487:-1 gene:ENSCPOG00000010050 transcript:ENSCPOT00000010141 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
SVDMAEPQPTSSGLTDEAALSCCADADPSTKDFLLQQTMLRIKDPKKSLDFYTRVLGMTL
LQKLDFPTMKFSLYFLAYEDKNDILAWAFSRKATLELTHNWGTEDDDNQSYHNGNSDPRG
FGHIGIAVPDVYGACKRFEELGVKFVKKPDEGKMKGLAFIQDPDGYWIEILSPNTMTEML
Download sequence
Identical sequences 10141.ENSCPOP00000009023 ENSCPOP00000009023 ENSCPOP00000009023

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]