SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSCPOP00000009113 from Cavia porcellus 76_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCPOP00000009113
Domain Number 1 Region: 151-234
Classification Level Classification E-value
Superfamily Translation initiation factor IF3, C-terminal domain 1.83e-17
Family Translation initiation factor IF3, C-terminal domain 0.0037
Further Details:      
 
Domain Number 2 Region: 73-143
Classification Level Classification E-value
Superfamily Translation initiation factor IF3, N-terminal domain 0.000000000183
Family Translation initiation factor IF3, N-terminal domain 0.004
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCPOP00000009113   Gene: ENSCPOG00000010148   Transcript: ENSCPOT00000010241
Sequence length 272
Comment pep:known_by_projection scaffold:cavPor3:scaffold_6:29137170:29141376:-1 gene:ENSCPOG00000010148 transcript:ENSCPOT00000010241 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAVFLLKRLTLQTIRTENNCIRCFNKHTVRKTPLSPTASAWRPPSLVHAQCLSTDEGAQD
DRKKKASKTLTNTGRKIHARIIRVFSEEGTDLGPMHRADTIRLMEERALRLVQRDADAEP
PEYQLMTGAQIHQERLRLREEEKAKPKSGPTVRKELTFSSNIGQHDLETKSKQIQQWIEK
NYQVQITIKKGKNADDPEHKPEEIFDHILQTMPGMATFLSRPQPVKGGRACMCILRHLTK
KEEKTHADSRAQKRDTLNKGNGGGGESDVIHP
Download sequence
Identical sequences H0VG87
ENSCPOP00000009113 10141.ENSCPOP00000009113 XP_003477301.2.53824 XP_012996543.1.53824 ENSCPOP00000009113

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]