SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSCPOP00000009259 from Cavia porcellus 76_3

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  ENSCPOP00000009259
Domain Number - Region: 52-80
Classification Level Classification E-value
Superfamily RILP dimerisation region 0.0785
Family RILP dimerisation region 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCPOP00000009259   Gene: ENSCPOG00000010310   Transcript: ENSCPOT00000010404
Sequence length 100
Comment pep:known_by_projection scaffold:cavPor3:scaffold_15:34525666:34537331:-1 gene:ENSCPOG00000010310 transcript:ENSCPOT00000010404 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
ASNMTKKKRENLGVALEIDGLEEKLSQCRRDLEAVSCRLHRTELSPEDRRSLEKERNSLM
SRASNYEQELKMLRRENRKNMLLSVAIFLLLALLYAHWTM
Download sequence
Identical sequences ENSCPOP00000009259 10141.ENSCPOP00000009259 ENSCPOP00000009259

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]