SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSCPOP00000009313 from Cavia porcellus 76_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCPOP00000009313
Domain Number 1 Region: 224-287
Classification Level Classification E-value
Superfamily RILP dimerisation region 3.14e-18
Family RILP dimerisation region 0.0000345
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCPOP00000009313   Gene: ENSCPOG00000010367   Transcript: ENSCPOT00000010461
Sequence length 370
Comment pep:known_by_projection scaffold:cavPor3:scaffold_32:20772126:20774852:1 gene:ENSCPOG00000010367 transcript:ENSCPOT00000010461 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MEPRRVTPGKPCRGPRVATGSRTAAELVYHLAGALGTELQELARRFGPEAAAGLVPLVVR
ALELLEQAAVGPAPDSLQVSAQQAEVELRRLREENEHLRREARAGPQEERALLLRLKEVT
DKQRDELRAHSRDLRQRSQETEALQEQLQRLLLVNAELRHKLAAVQAQLRAAQDREREHE
LPREGARERAEGEKQQPNPASPEDLVDALGQPGRPVEAGQCGFSREELEQILQERNELKA
KVFLLKEELAYFQRELLTDHRVPGLLLEAMKVAVKKQRKKIKAKMLGTPEEAESSDDEDG
SWPLLSKNKEDDSPPPESRVQSFFGLWCRSEAEAPRAETGSTSPSERGGEEEAPQQPHVE
PVGTPQAPNS
Download sequence
Identical sequences ENSCPOP00000009313 ENSCPOP00000009313 XP_003469728.1.53824 10141.ENSCPOP00000009313

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]