SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSCPOP00000009350 from Cavia porcellus 76_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCPOP00000009350
Domain Number 1 Region: 367-477,590-740
Classification Level Classification E-value
Superfamily Periplasmic binding protein-like II 2.57e-56
Family Phosphate binding protein-like 0.00000842
Further Details:      
 
Domain Number 2 Region: 7-353
Classification Level Classification E-value
Superfamily Periplasmic binding protein-like I 9.03e-26
Family L-arabinose binding protein-like 0.0047
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCPOP00000009350   Gene: ENSCPOG00000010412   Transcript: ENSCPOT00000010506
Sequence length 938
Comment pep:known_by_projection scaffold:cavPor3:scaffold_62:5961760:6441265:1 gene:ENSCPOG00000010412 transcript:ENSCPOT00000010506 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
PVSLLFPACDLMTQGILALVTSTGCASANALQSLTDAMHIPHLFVQRNPGGSPRTACHLN
PSPDGEAYTLASRPPVRLNDVMLRLVTELRWQKFVMFYDSEYDIRGLQSFLDQASRLGLD
VSLQKVDKNISHVFTSLFTTMKTEELNRYRDTLRRAILLLSPQRAHSFISEAVETNLASK
DSHWVFVNEEISDPEILDLVHSALGRMTVVRQIFPSAKDNQKCMRNNHRISSLLCDPQEG
YLQMLQISNLYLYDSVLMLANAFHRKLEDRKWHSMASLNCIRKSTKPWNGGRSMLDTIKK
GHITGLTGEMEFREDSSNPYVQFEILGTTYSETFGKDMRKLATWDSEKGLNGSLQERPMG
SRLQGLTLKVVTVLEEPFVMVAENILGQPKRYKGFSIDVLDALAKALGFKYEIYQAPDGR
YGHQLHNTSWNGMIGELISKRADVAISAITITPERESVVDFSKRYMDYSVGILIRKPEEK
ISIFSLFAPFDFAVWACIAAAIPVVGVLIFVLNRIQAMRAQSAAQPRPSASATLHSAIWI
VYGAFVQQGGDSSVNSMALRIVMGSWWLFTLIVCSSYTANLAAFLTVSRMDNPIRTFQDL
SKQVEVPYGTVRDSAVYEYFRAKGTNPLEQDSTFAELWRTISKNGGADNCVSSPSEGIRK
AKKGNYAFLWDVAVVEYAALTDDDCSVTVIGNSISSKGYGIALQHGSPYRDLFSQRILEL
QDTGDLDVLKQKWWPHTGRCDLASHSSAQTDGKALKLHSFAGVFCILAIGLLLACLVAAL
ELWWSSNRCHQETPKEDKEVNLEQVHRRINSLMDEDIAHKQISPASIELSALEMGGLAPS
PALEPTREYQNTQLSVSTFLPEQSGHGAGRTLSAGPSSSLPLPLSSAATMPPIQCKHRSP
NGGLFRQSPVKTPIPMSFQPVPGGVLPEALDTSHGTSI
Download sequence
Identical sequences ENSCPOP00000009350 10141.ENSCPOP00000009350 ENSCPOP00000009350

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]