SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSCPOP00000009424 from Cavia porcellus 76_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCPOP00000009424
Domain Number 1 Region: 43-186
Classification Level Classification E-value
Superfamily C-type lectin-like 7.52e-33
Family C-type lectin domain 0.00031
Further Details:      
 
Weak hits

Sequence:  ENSCPOP00000009424
Domain Number - Region: 8-50
Classification Level Classification E-value
Superfamily PsbZ-like 0.0445
Family PsbZ-like 0.0098
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCPOP00000009424   Gene: ENSCPOG00000010494   Transcript: ENSCPOT00000010589
Sequence length 186
Comment pep:known_by_projection scaffold:cavPor3:scaffold_28:1591925:1600780:-1 gene:ENSCPOG00000010494 transcript:ENSCPOT00000010589 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
RSASDIYFTLNFPTAFQAQDNYRPQQNAFFSRCSLFYIVAIVLGLLNVLLISLLLYQWIL
CKGPGDSACASCSSCPDFWMRYKNHCYYFSVEKKDWNSSLEFCTASDAQLLMLMDNQEMS
LLQNLINQDFHWIGLRKNSSWRWEDGSPLNFSRISSNSLVQRCGAISKEGLHGSSCEVLL
QWICKK
Download sequence
Identical sequences ENSCPOP00000009424 ENSCPOP00000009424 10141.ENSCPOP00000009424

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]