SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSCPOP00000009427 from Cavia porcellus 76_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCPOP00000009427
Domain Number 1 Region: 438-924
Classification Level Classification E-value
Superfamily ALDH-like 5.89e-165
Family ALDH-like 0.000000000648
Further Details:      
 
Domain Number 2 Region: 24-223
Classification Level Classification E-value
Superfamily Formyltransferase 1.7e-48
Family Formyltransferase 0.0000000214
Further Details:      
 
Domain Number 3 Region: 228-327
Classification Level Classification E-value
Superfamily FMT C-terminal domain-like 8.32e-23
Family Post formyltransferase domain 0.0000195
Further Details:      
 
Weak hits

Sequence:  ENSCPOP00000009427
Domain Number - Region: 346-417
Classification Level Classification E-value
Superfamily ACP-like 0.00208
Family Acyl-carrier protein (ACP) 0.027
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCPOP00000009427   Gene: ENSCPOG00000010497   Transcript: ENSCPOT00000010592
Sequence length 925
Comment pep:known_by_projection scaffold:cavPor3:scaffold_171:1272022:1312929:1 gene:ENSCPOG00000010497 transcript:ENSCPOT00000010592 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MLLRGGSALRRFSTGRVYFKNKLKLALIGQSLFGQEVYSQLRKEGHRVVGVFTVPDEDGR
ADPLALAAEKDGTPVFKFPRWRVKGRTVQEVAEAYRAVGAELNVLPFCTQFIPMDIISSP
RLGSIVYHPSLLPRHRGASAINWTLIMGDKKAGFSVFWADDGLDTGPILLQRSCDVKPND
TVDTLYNGFLFPEGVKAMVEAVQLIADGKAPRIPQPEEGATYEGIQRKVNAEIRWDQTAE
ALHNWIRGHDKVPGAWAEINGQAVTFYGSSLLSGSVPPGDTLDIKGATKPGLVTKSGLVL
FGSDGKALLVRNLQFEDGKMIAASQYFSAGEASAVELTAEELRVAETIKVIWAGILSNVQ
VIEASTDFFKSGARSMDVVRLVEEIRQKCGGLQLRNEDVYLATRFGDFIQKVVRRLRGEE
REEELVVDYVSKEANGLTVRMPHQCFINGEFVDAEDGETYPTVNPADGSTICKVAYASLA
DVDRAVAAAKDAFEHGEWGRMNARDRGRLMYRLADLLEENQEELATIEALDSGAVYTLAL
KTHIGMSVQTFRYFAGWCDKIQGSTIPINQARPNHNLTFTRKEPIGVCAIIVPWNYPLMM
LAWKSAACLAAGNTLVLKPAQVTPLTALKFAELSAKAGFPKGVINILPGSGGVAGQRLSE
HPDIRKLGFTGSTLIGKQIMKSCAASNLKKVSLELGGKSPLIIFQDCELDKAVRMGMDAV
FFNKGENCIAAGRLFVEESAHDEFVTRVVEEIKKMKIGDPLDRSTDHGPQNHQAHLEKLL
QYCEAGVKEGATLVYGGRQVQRPEKGFFMEPTVFTDVEDHMFLAKEESFGPIMVISKFPN
GDIDGVLQRANNTEYGLASGVFTRDINKAMYVSERLDAGTVFINTYNKTDVAAPFGGVKQ
SGFGKDLGEEALNEYLKTKTVTLEY
Download sequence
Identical sequences 10141.ENSCPOP00000009427 ENSCPOP00000009427 ENSCPOP00000009427

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]