SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSCPOP00000009626 from Cavia porcellus 76_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCPOP00000009626
Domain Number 1 Region: 256-434
Classification Level Classification E-value
Superfamily ITPase-like 1e-30
Family YjjX-like 0.0038
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCPOP00000009626   Gene: ENSCPOG00000010724   Transcript: ENSCPOT00000010822
Sequence length 442
Comment pep:known_by_projection scaffold:cavPor3:scaffold_6:16285715:16312526:-1 gene:ENSCPOG00000010724 transcript:ENSCPOT00000010822 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MMEESGIETTPPATPPLTLAGMAAPAMSSTPAAASSFASPNVSTMESLPPHAYSASQPSH
PPVQPSAPLPFVPLSPPPSVPPLSTSVSPPLPSTTAATFSNPPLSHFPPASSAPGALLPA
PPPGPPISGFSVGASYDITRGHAGRAPQTPLMPSFSAPPVTGVLPTPITQQACLTSLAPG
TGITSAITFPEEQEDPRVNRSHDEASAGGIWGFIKGVAGNPMVKSVLDKTKHSVESMITT
LDPGMAPYIKSGGELDIVVTSNKEVKVAAVRDAFQEVFGLAVVVGEAGQSNIAPQPVGYA
AGLKGAQERIDSLRRTGVIHEKQTAVSVENFIAELLPDKWFDIGCLVVEDPVHGIHLETF
TQATPVPLEFVQQAQSLTPQDYNLRWSGLLVTVGEVLEKSLLNVSRTDWHVAFTGMSRRQ
MIYSAAKAVAGMYKQRLPPRTV
Download sequence
Identical sequences H0VHJ0
XP_003477412.1.53824 ENSCPOP00000009626 10141.ENSCPOP00000009626 ENSCPOP00000009626

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]