SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSCPOP00000009705 from Cavia porcellus 76_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCPOP00000009705
Domain Number 1 Region: 621-1037
Classification Level Classification E-value
Superfamily Galactose mutarotase-like 1e-91
Family alpha-mannosidase, C-terminal domain 0.03
Further Details:      
 
Domain Number 2 Region: 249-516
Classification Level Classification E-value
Superfamily Glycoside hydrolase/deacetylase 8.45e-83
Family alpha-mannosidase 0.01
Further Details:      
 
Domain Number 3 Region: 517-617
Classification Level Classification E-value
Superfamily Families 57/38 glycoside transferase middle domain 9.48e-26
Family alpha-mannosidase, domain 2 0.0097
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCPOP00000009705   Gene: ENSCPOG00000010809   Transcript: ENSCPOT00000010907
Sequence length 1042
Comment pep:known_by_projection scaffold:cavPor3:scaffold_98:4146071:4155671:1 gene:ENSCPOG00000010809 transcript:ENSCPOT00000010907 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAAAVPALKHWRTALERVEKFVSPLYFTDCNLRGRLFGQRHPVAALSSFLTPERLRYQDA
VQQDFRPAQVGDRFGPTWWTCWFRVELIIPEAWIGQEIHLCWESDGEGLVWRDGEPVQGL
TTEGEKNSYILTNRLGEGDPRSLTLYVEVACSGLLGAGKGTMIAPPDPEKMFQLKRAELA
VFHRDIHLLLVDLELLLGIAKGLGKDNQRSFQALYTANQMVNVCDPARPETFPVAQALAS
HFFGQRGGDSQHTLHAMGHCHIDTAWLWPFKETVRKCARSWVTAVKLMEQNADFIFVCSQ
AQQLEWVKSHYPSLYAQLQEFACRGQFVPVGGTWVEMDGNLPSGEAMVRQFLQGQRFFLQ
EFGKLCSEFWLPDTFGYSAQLPQIMRGCGITRFLTQKLSWNLVNSFPHHTFLWEGLDGSP
VLVHFPPGDSYGMQGNVEEVLKTVTNNQDKGRANHSAFLFGFGDGGGGPTQTMLDRLRRL
DHTDGLPRVQLSSPDQLFQALESDQGKLCTWVGELFLELHNGTYTTHAQIKKGNRECERI
LHDVELLSSLALARGTHFLYPAAQLQHLWRLLLLNQFHDVVTGSCIQLVAEDAMKHYEDI
RSHGNTLLSAAAGALCAGEPGPKGLLVVNTLPWKRTEVLALPNPGGAQTLALVTVPSIGY
APAPPAPTSPQPLLPQQPVSVMQETDGSVTLDNGIIRVRLDPTGHLTSLILVASGREAVA
EGALGNQFVLFDDVPLYWDAWDVMDYHLETRKPVLAQAGTLAVGSEGGLRGSAWFLLQIS
PSSRLSQEVVLDIGCPYVRFHTEVYWHEAHKFLKVEFPARVRSPQATYEIQFGHLQRPTH
YNTSWDWARFEVWTHRWMDLSEHGFGLALLNDCKYGASVRGNILSLSLLRAPKAPDATAD
MGCHKFTYALMPHEGSFQDAGVIPAAYSLNFPLLVLPAPGPAPTTAWSAFSLSSPAVVLE
TIKQAETITQKRTLVLRLYEAHGSHVNCWVHTSLPVQEAVLCDLLERRDPAGHLPFQDSR
LKVTFSPFQVRSLLLVLQPPST
Download sequence
Identical sequences ENSCPOP00000009705 XP_003463657.1.53824 ENSCPOP00000009705 10141.ENSCPOP00000009705

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]