SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSCPOP00000009798 from Cavia porcellus 76_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCPOP00000009798
Domain Number 1 Region: 288-639
Classification Level Classification E-value
Superfamily Periplasmic binding protein-like II 1.14e-140
Family Transferrin 0.000000000058
Further Details:      
 
Domain Number 2 Region: 2-284
Classification Level Classification E-value
Superfamily Periplasmic binding protein-like II 2e-103
Family Transferrin 0.0000000011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCPOP00000009798   Gene: ENSCPOG00000010905   Transcript: ENSCPOT00000011006
Sequence length 641
Comment pep:known_by_projection scaffold:cavPor3:scaffold_7:47209565:47227495:-1 gene:ENSCPOG00000010905 transcript:ENSCPOT00000011006 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
LQENKADAITLDGGQLYEAALDPYNLRPVAAEVYGSEANPRTHYYAVAVAKRSRNFRLDQ
LQGLRSCHTGINRTAGWRIPTGVLRPFLNWRGPPEPIEAAVAKFFSASCVPGVDGVRFPS
LCRQCSGTGTNKCAFSTQEPYFGYSGAFKCLRDGAGDVAFIKASTVFEDLPDKAQREEYK
LLCPDNTWRPVDEYKQCHLARVPSHAIVARSVNGREDLIWEFLRQAQEKFGKGKSSGFQL
FGSPRGKRDLLFKDSALGFVRVPKRVDAGLYLGFGYLSSIRNMQETEADVAARYSRVVWC
AIGPEEKRKCDRWSGVSGGKVTCVAARTTEDCITLTMKGEADAMSLDGGFIYSAGRCGLV
PVLAENQRSQEKPGSDCVNRPPEGYLAVAAVRTSDTSLTWNSLRGRKSCHTGVDRTAGWV
IPMGLILNQTRSCRFDEFFSQSCAPGANPTSRLCALCVGNDKGEKKCVPNSQERYFGYTG
AFRCLAERAGEVAFLKDSTVLQNTDGKNTESWAQNLKLEDFQLLCLDGTRKPVTEARSCH
LAMAPNHAVVSRKDKAKLLEEVLLNQQTRFGRNGSRCPGEFCLFQSETKNLLFNDNTECL
ARLHGKTTYEEYLGREYLAAITNLKRCSPSPLLEACDFLSQ
Download sequence
Identical sequences 10141.ENSCPOP00000009798 ENSCPOP00000009798 ENSCPOP00000009798

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]