SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSCPOP00000009871 from Cavia porcellus 76_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCPOP00000009871
Domain Number 1 Region: 595-732
Classification Level Classification E-value
Superfamily C-type lectin-like 2.8e-45
Family C-type lectin domain 0.00016
Further Details:      
 
Weak hits

Sequence:  ENSCPOP00000009871
Domain Number - Region: 218-424
Classification Level Classification E-value
Superfamily Tropomyosin 0.00105
Family Tropomyosin 0.019
Further Details:      
 
Domain Number - Region: 99-245
Classification Level Classification E-value
Superfamily Methyl-accepting chemotaxis protein (MCP) signaling domain 0.0118
Family Methyl-accepting chemotaxis protein (MCP) signaling domain 0.026
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCPOP00000009871   Gene: ENSCPOG00000010983   Transcript: ENSCPOT00000011084
Sequence length 739
Comment pep:known_by_projection scaffold:cavPor3:scaffold_14:41436722:41581461:-1 gene:ENSCPOG00000010983 transcript:ENSCPOT00000011084 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
DDFPEEEEVQSFGYKRFGIQEGTQCTKCKNNWALKFSIILLYILCALLTITVAILGYKVV
EKMDNVTGGMETSRQTYDDKLTAVESDLKKLGDQTGKKAISTNSELSTFRSDILDLRQQL
REITEKTTKNKDTLEKLQAGGDALVDRQSQLKETLENNSFLITTVNKTLQAYNGYVTNLQ
QDTSVLQSNLQNQMYSHNVVIMNLNNLNLTQLQQRNLITNLQRSVDDTSQAIQRIKNDFQ
NLQQVFLQAKKDTDWLKEKVQSLQMLAANNSALAKANNDTLEDMNSQLGSFTGQMDNITS
ISQANEQNLKDLQDLHKDAENRTAIKFSQLEERFQLFETDIVNIISNISYTAHHLRTLTS
NLNEVRTTCTDTLTRHTDDLTSLNNTLANIRLDSVSLRMQQDMMRSRLDTEVANLSVIME
EMKLVDSKHGQLIKNFTILQGPPGPRGPKGDRGSQGPPGPTGSKGQKGEKGEPGPPGPAG
ERGPVGPAGPPGERGSKGSKGSQGPKGSRGSPGKPGPQGPSGDPGPPGPPGKEGPPGPQG
PPGFQGLQGTVGEPGVPGPRGPPGLPGVTGMPGPKGPPGPPGPSGAAAPLALLNVPTPVP
EDNGCPPHWKNFTDKCYYFSVEKETFEDAKLFCEDKSAHLVFIHTREEQQWIKKQVVGRD
SHWIGLTDLEQENEWKWLDGSPAEYKNWKAGQPDNWGHGHGPGEDCAGLIYAGQWNDFQC
EDINNFICEKDRETGKQSV
Download sequence
Identical sequences ENSCPOP00000009871 10141.ENSCPOP00000009871 ENSCPOP00000009871

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]