SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSCPOP00000010037 from Cavia porcellus 76_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCPOP00000010037
Domain Number 1 Region: 5-128
Classification Level Classification E-value
Superfamily DNA clamp 1.4e-19
Family DNA polymerase processivity factor 0.012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCPOP00000010037   Gene: ENSCPOG00000011163   Transcript: ENSCPOT00000011267
Sequence length 384
Comment pep:known_by_projection scaffold:cavPor3:scaffold_42:7864863:7869453:1 gene:ENSCPOG00000011163 transcript:ENSCPOT00000011267 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MKCVVTGSNVKVLGKAVHSLSRIGDELYLEPLDDGLSLRTVNSSRSAYACFLFAPLFFQQ
YQPSTPGQDLLRCKILMKSFLSIFRSLAMLEKTVEKCCISLNDRSSCLVVQLHCKYGVRK
THNLSFQDCESLQAVFNLASCPHVLRAPARILGEAVLPFPPALAEVTLGIGRGRRVILRS
YQEEEAESTSKAMVTEMSIGEEDFQQLQAPEGMGITFCLKEFRGLLSFAESANLPVSIHF
DAPGRPAIFSIEDSLLDGHFVLATLLELDPPTQDLSSSKHHQPMPQLQSHSTPYQDNFAN
DDIDSYMIAMETTVGSEGSRALPSVSLMPGPHSEEEDNEAEPSPVPGTPPPKKFRSLFFG
SILAPTHSPQGPSPVLAEDSDGEG
Download sequence
Identical sequences A0A286XFG3
10141.ENSCPOP00000010037 ENSCPOP00000010037 XP_003468336.1.53824 ENSCPOP00000010037

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]