SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSCPOP00000010049 from Cavia porcellus 76_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCPOP00000010049
Domain Number 1 Region: 343-474
Classification Level Classification E-value
Superfamily C-type lectin-like 7.76e-42
Family C-type lectin domain 0.0000917
Further Details:      
 
Domain Number 2 Region: 199-332
Classification Level Classification E-value
Superfamily C-type lectin-like 2.87e-37
Family C-type lectin domain 0.00042
Further Details:      
 
Domain Number 3 Region: 794-920
Classification Level Classification E-value
Superfamily C-type lectin-like 6.75e-35
Family C-type lectin domain 0.00029
Further Details:      
 
Domain Number 4 Region: 483-620
Classification Level Classification E-value
Superfamily C-type lectin-like 3.78e-34
Family C-type lectin domain 0.0012
Further Details:      
 
Domain Number 5 Region: 931-1082
Classification Level Classification E-value
Superfamily C-type lectin-like 1.64e-30
Family C-type lectin domain 0.00067
Further Details:      
 
Domain Number 6 Region: 630-780
Classification Level Classification E-value
Superfamily C-type lectin-like 3.37e-28
Family C-type lectin domain 0.00038
Further Details:      
 
Domain Number 7 Region: 1227-1367
Classification Level Classification E-value
Superfamily C-type lectin-like 1.19e-27
Family C-type lectin domain 0.0017
Further Details:      
 
Domain Number 8 Region: 1099-1223
Classification Level Classification E-value
Superfamily C-type lectin-like 1.27e-25
Family C-type lectin domain 0.0013
Further Details:      
 
Domain Number 9 Region: 5-136
Classification Level Classification E-value
Superfamily Ricin B-like lectins 2.39e-24
Family Cysteine rich domain 0.004
Further Details:      
 
Domain Number 10 Region: 136-194
Classification Level Classification E-value
Superfamily Kringle-like 1.57e-20
Family Fibronectin type II module 0.00079
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCPOP00000010049   Gene: ENSCPOG00000011177   Transcript: ENSCPOT00000011281
Sequence length 1451
Comment pep:known_by_projection scaffold:cavPor3:scaffold_65:3763731:3787082:1 gene:ENSCPOG00000011177 transcript:ENSCPOT00000011281 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
SFPEPDVFLIFSHGLQGCLEAQGAQVRVTPACNASLPAQRWKWVSRNRLFNLGTMQCLGT
GWPGTNSTTSLGMYECDREALSLRWHCRTLGDQLSLLLGGRAGNTSKSGTLERGDQTHSG
QWHIYGSEEDLCARPYYEVYTIQGNSHGKPCTIPFKYDNQWFHSCTSTGREDGHLWCATT
QDYGKDERWGFCPIKSNDCETFWDKDQLTDSCYQFNFQSTLSWREAWASCEQQGADLLSI
TEIHEQTYINGLLTGYSSTLWIGLNDLDTSGGWQWSDNSPLKYLNWESDQPDNPSEENCG
VIRTESSGGWQNRDCSIALPYVCKKKPNATAEPTPPDRWANMKVECDPSWQPFQGHCYRL
QAEKRSWQESKKACLRGGGDLLSIHSMAELEFITKQIKQVDPEVEELWIGLNDLKLQMNF
EWSDGSLVSFTHWHPFEPNNFRDSLEDCVTIWGPEGRWNDSPCNQSLPSICKKAGQLTQG
APEEDHGCRKGWTWHSPSCYWLGEDQVTYSEARHLCTDHGSQLVTITNRFEQAFVSSLIY
NWEGEYFWTALQDLNSTGSFRWLSGDEVMYTHWNRDQPGYSRGGCVALATGSAMGLWEVK
NCTSFRARYICRQSLGTPVTPELPGPDPTPSLTGSCPPGWASDPKLRHCYKVFSSERLQD
KKSWIQAQGACQELGAQLLSLATYEEEHFVANMLNKIFGESEPEIHEQHWFWIGLNRRDP
RVGQSWRWSDGLGFSYHNFDRSRHDDDDIRGCTVLDLASLQWVAMQCETQLDWICKIPRG
ADVQEPDVNPQGRREWLRFQEAEYKFFEHHSTWAQAQRICTWFQAELTSVHSQAELDFLG
HNLQKFSRGQEQHWWIGLHTLETDGRFRWTDGSIINFISWAPGKPRPIGKDQKCVYMTAS
REDWGDQRCTTALPYICKRSNSTGETQPSDLPSAVLGGCPPGWNQFLNKCFRIQGEDPQD
QVKWSEAQFSCEQQEAQLVTIANPLEQGGTVAFITASLPNVTFDLWIGLHASQRDFQWVE
QEPLLYTNWAPGEPSGPSPAPSGNKPTSCAVVLHSPSAHLTGRWDDRSCVEETHGFICQK
GTDPTLSPSPAASPPAPGAELSYLNGTFRLLQKPLRWHDALLLCESRNASLAHVLDPYTQ
AFLTQAARGLRAPLWIGLASEEGSRRYTWVSEEPLNYASWRDGEPQQAGGCAYVDVDGAW
RTTNCDTKLQGAVCGVSRGPPPPRRVSYHGSCPQGLADSSWIPFRGHCYSFHTELLLGHQ
EALQRCQRAGGAVLSILDEMENVFVWEHLQDSDGQSRGAWLGMNFNPKGGMLVWQDNTAV
NYSNWGPPGLGPSMLSHNSCYWIQSSSGLWRPGACSNVTMGMVCKLPRAEESKFSPSAAL
PENPAALVVVLMAVLLLLALLTAALILYRRRQSAERGAFEGARYSRSSSSPGETTEKNIL
VSDMEMNEQQD
Download sequence
Identical sequences ENSCPOP00000010049 ENSCPOP00000010049 10141.ENSCPOP00000010049

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]