SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSCPOP00000010138 from Cavia porcellus 76_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCPOP00000010138
Domain Number 1 Region: 111-358
Classification Level Classification E-value
Superfamily vWA-like 8e-87
Family Integrin A (or I) domain 0.000000000592
Further Details:      
 
Domain Number 2 Region: 354-443
Classification Level Classification E-value
Superfamily Integrin domains 7.85e-33
Family Integrin domains 0.0000041
Further Details:      
 
Domain Number 3 Region: 607-691
Classification Level Classification E-value
Superfamily Integrin beta tail domain 7.98e-24
Family Integrin beta tail domain 0.0000057
Further Details:      
 
Domain Number 4 Region: 7-61
Classification Level Classification E-value
Superfamily Plexin repeat 0.00000000000068
Family Plexin repeat 0.0000561
Further Details:      
 
Domain Number 5 Region: 565-606
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000112
Family Integrin beta EGF-like domains 0.00033
Further Details:      
 
Domain Number 6 Region: 534-562
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000109
Family Integrin beta EGF-like domains 0.0013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCPOP00000010138   Gene: ENSCPOG00000011275   Transcript: ENSCPOT00000011381
Sequence length 763
Comment pep:novel scaffold:cavPor3:scaffold_65:3105325:3138608:1 gene:ENSCPOG00000011275 transcript:ENSCPOT00000011381 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
LSVAEPNICATRGVSSCQQCLAVSPMCAWCSDKNLPLSSPRCNLKENLLADNCAVESIEF
PVSEVQILEARPLSDKGSGDSSQITQVSPQRIALRLRPDDSKKFSIQVRQVEDYPVDIYY
LMDLSYSMKDDLRSIQNLGTKLASEMRKLTSNLRIGFGAFVDKPVSPYMYISPPEALTNP
CYHLKTRCLPMFGYKHVLTLTDQMNRFNEEVKKQSVSRNRDAPEGGFDAIMQATVCDEKI
GWRNDASHLLVFTTDAKTHIALDGRLAGIVQPNDGQCHIGSDNHYSASTTMDYPSLGLMT
EKLSQNNINLIFAVTENVVRLYQNYSELIPGTTVGVLSADSSNVLQLIVNAYGKIRSKVE
LEVRDLPEELSLSFNATCLNNEVIPGLKSCVGLKIGDTVSFSIEAKVRGCPQEKEKSFTI
KPVGFKDSLTIQVTFDCDCTCQAYAEPFSHRCNNGNGTFECGVCLCGPGWLGSQCECSEE
DYRPSQQDECSPKEGQPVCSQRGECCGQCLCHSSDFGKIGKYCECDDSCVRYKGEMCSGH
GQCSCGDCLCDSDWTGYYCNCTTRTDTCMSSNGLLCSGRGKCECGSCVCIQPGSYGDTCE
KCPTCPDACTFKKECVECKKFDRGVLFEDKTCNRYCRDEIVPVKELKDSGKDAVNCTYKN
EEDCVVRFQYYEDSSGKSILYVIEEPECPKGPDILVVLMSVMGAILLIGLATLLIWKLLI
TIHDRKEFAKFEEERARAKWDTANNPLYKEATSTFTNITYRGT
Download sequence
Identical sequences ENSCPOP00000010138 ENSCPOP00000010138 10141.ENSCPOP00000010138

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]