SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSCPOP00000010142 from Cavia porcellus 76_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCPOP00000010142
Domain Number 1 Region: 337-513,548-714
Classification Level Classification E-value
Superfamily (Trans)glycosidases 9.22e-84
Family YicI catalytic domain-like 0.00026
Further Details:      
 
Domain Number 2 Region: 1205-1404,1449-1610
Classification Level Classification E-value
Superfamily (Trans)glycosidases 1.69e-76
Family YicI catalytic domain-like 0.00032
Further Details:      
 
Domain Number 3 Region: 92-336
Classification Level Classification E-value
Superfamily Galactose mutarotase-like 8.79e-51
Family YicI N-terminal domain-like 0.0083
Further Details:      
 
Domain Number 4 Region: 972-1202
Classification Level Classification E-value
Superfamily Galactose mutarotase-like 4.71e-43
Family YicI N-terminal domain-like 0.0082
Further Details:      
 
Domain Number 5 Region: 1613-1693
Classification Level Classification E-value
Superfamily Glycosyl hydrolase domain 3.02e-20
Family Putative glucosidase YicI, domain 3 0.01
Further Details:      
 
Domain Number 6 Region: 717-797
Classification Level Classification E-value
Superfamily Glycosyl hydrolase domain 7.91e-17
Family Putative glucosidase YicI, domain 3 0.02
Further Details:      
 
Domain Number 7 Region: 928-981
Classification Level Classification E-value
Superfamily Trefoil 0.0000000000693
Family Trefoil 0.0048
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCPOP00000010142   Gene: ENSCPOG00000011280   Transcript: ENSCPOT00000011386
Sequence length 1812
Comment pep:known_by_projection scaffold:cavPor3:scaffold_10:7031264:7091088:-1 gene:ENSCPOG00000011280 transcript:ENSCPOT00000011386 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MARKKLKKFTPLEIALSIILLIVFIIAVVLIVLLATKGLSLVLQERKTTKISPDPETTGT
PVPNTTDAACPVVDELERINCIPDQPPTKATCDQRGCCWKPQGAISIPWCYYSKNHGYQM
EGNLVNTNAGFTAQLKALPSASLFGNDVDNVLLTAEYQTSNRFHFKLTDQTKNRYEVPHE
HVQSFNGNAATSLNYQVEVSKQPFSIKVMRRSNSRVLFDSSIGPLLFADQFLQLSIRLPS
ANVYGLGEHVHQQYRHDMNWRTWPIFTRDTIPNADGTNLYGAQPFFLCLEDASGLSFGVF
LMNSNAMEVALQPTPAITYRTIGGILDFYVFLGNTPEQVVQEYLELIGRPSLPSYWSLGF
HLSRYDYGTLDKMKEVVDRNRAAQLPYDVQHADIDYMDERKDFTYDPVSYRGFPDFAKEL
HNNGQKLVIIVDPAISNDSSSSNRYGPFDRGSAMNIWVNSSDGVNPLIGEVWPGRTVFPD
YTNPNCAVWWTREFELFYNQVEFDGIWIDMNEVSNFVDGSVSGCSTNNLNYPPFTPRVLD
GYLFCKSLCMDAVQHWGQQYDVHNLYGYSMAIATAEAVKTLFPSKRSFILTRSTFAGSGK
FAAHWLGDNAATWNDLQWSIPGMLEFNLFGIPMVGADICGFTSDTSEELCRRWMQLGAFY
PFSRNHNGQGFKDQDPASFGPDSLLLNSSRHYLNIRYTLLPYLYTLFYHAHSRGDTVARP
LLHEFYGDNNTWDIYRQFLWGPGLLITPVLEEGEEKVTAYVPDAIWYDYETGGQLGWRKQ
NIEMELPGDKIGLHLRGGYIFPIQQPSTTTVASRQNPLGLIIALDENKEAKGELFWDDGE
SKDTVLNKVYLLCEFSVTENKLDVTISQSTYQDPNNLAFQEIKILGTQEPTNVTVKHNGV
LTQTSSKVTYDSSLKVAIITEINLVLGEAYTVEWSTTTRDEIKIDCYPDAHGVTEANCIA
RGCVWEESSTTGVPFCYFVTDLYSVSNVQYDSQGASADISLKSSSYANAFPSTPVSPLRL
QVTYHKDEMLQFKIYDPNNNRYEVPVPLNIPTVPSSTSQSRLYDVLIKENPFGIEIRRKS
TGTVIWDSQVLGFTFNDMFLRISTRLPSSYIYGFGETEHTAFRRDLNWHTWGMFSRDQPP
GYKLNTYGVHPYYMGLEEDGNAHSVLLLNSNAMDVTFQPLPALTYRTTGGILDFYVFLGP
TPELVTQQYTEVIGRPVMVPYWSLGFQLCRYGYENDSEIASLYDDMVAAQIPYDVQYSDI
DYMERQLDFTLSPKFAGLPALIDRLKADGMRVILILDPAISGNETQPYPAFTRGVEDDVF
IKYPNDGGIVWGKVWPDFPDVVVDPSLDWDSQVEQYRAYVAFPDFFRNSTVLWWKREIQE
LYNNTQNPEKSLKFDGMWIDMNEPASFVNGAVPSGCRNGTLNHPPYMPYLEDRNGGLSSK
TLCMEGEQILPDGSRVRHYDVHSLYGWSQTRPTYEAVQEVTGQRGIVITRSTFPSSGRWA
GHWLGDNTAAWDQLKKSIIGMMEFSLFGMSYTGADICGFFQDADYEMCARWMQLGAFYPF
SRNHNTIGTRRQDPVSWDAAFVTISKSVLETRYTLLPYLYTLMHKAHTEGVTVVRPLLHE
FVSDRVTWDVDSQFLLGPALLVSPVLEPDARSVKAYFPGAHWYDYYTGVNINARGQWKDV
AAPLDHINLHVRGGYILPLQEPALNTHLSRKNPLGLLIALDENKEARGELFWDDGESKDT
VANNVYLLCEFSATQNRLEVKISQSTYKDPNNLAFQEIKILGIEEPINVTVKHNGVLSQA
SPNVTYDPNLKV
Download sequence
Identical sequences 10141.ENSCPOP00000010142 ENSCPOP00000010142 ENSCPOP00000010142

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]