SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSCPOP00000010189 from Cavia porcellus 76_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCPOP00000010189
Domain Number 1 Region: 333-431
Classification Level Classification E-value
Superfamily PYP-like sensor domain (PAS domain) 2.39e-18
Family Hypoxia-inducible factor Hif2a, C-terminal domain 0.017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCPOP00000010189   Gene: ENSCPOG00000011333   Transcript: ENSCPOT00000011439
Sequence length 1243
Comment pep:known_by_projection scaffold:cavPor3:scaffold_13:24926573:24955309:1 gene:ENSCPOG00000011333 transcript:ENSCPOT00000011439 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MDGFVEFPPSPTKEPMEPQAGQASMQEDMDMSSGCSGNEAPENSSTGQDSQGSDFDHRKE
LGMIVEPPNPQRFPKTPSAFSLMLVEPEPNLSTSGCSSKGSPKADTHKELIRTLRELKVH
LPADKKAKGKASTLATLKYALRSVKQVKANEEYYQLLMSSESQPFSVDVPSYTVEQVEGV
TSEYMGKNSDMFVVAVSLVSGKILYISSQVASIFHCKQDTFSDAKFVEFLAPHDVSVFHS
CTTPCRLPSWSMCSGVDSFTQECMEEKSFFCRVSVGKNHENEICYQPFRMTPYLVKVQEP
LGAESQLCCLLLAERVHSGYEAPRIPPEKRIFTTTHTPNCLFQDVDERAVPLLGYLPQDL
IEKPVLLQLHPSDRPLMLAIHKKILQSGGQPFDYSPLRFRARNGEYITLDSSWSSFINPW
SRKISFIIGRHKVRVGPLNEDVFAVLPCVEEKALHPNIQELTEQIHRLLLQPVPHSGSSG
YGSLGSNGSHEQLMSQTSSSDSTGHEEARHRRAEICKNSNKTKTKGQFPHESGKQKKKSV
TELQSSALAQVKAVPVAEDSSGASLPKIGFPEELACKDQPTCSYQQISCLDGVMRYLESC
TEATTLKRKCEFPANIPSRKATVSPGLHTGEATSKVSSHAEVSARLSSLALPGKAESVVS
LTSQCSYSSTIVHVGDKKLQPELETVEDATSGPESLDCLPGGHSQEKGPLQRLGLTKEVL
ASHTQKEEQSFLQKFREVRRLGILQAHCQHYLQERTRGQSSERVAPGLRNAAGIDSSWKK
TGKNRKLKSKWAKPRDSSESTGSGGPPPPRPPLVGLNATAWSPSDTSQSSCSAVPFPTPV
PSYSLPVFPAPGIVPAPGATPPAVPHASFPVPTVAMGTQHEFAVQPLPFPAPMAPVVAFM
LPSYPFPATTSLPQAFFPGHPTLPSEMTPASQPECPSQTSLPQQPCSCPATPATPPAATL
ATSRASPPLFQSRGSSPLQLNLLQLEEAPEGSTGATGTVTAGPDCTPAHDRQPKAPPTHD
EPSDAQNSDALSTSSDLLNLLLSEDLCSATGSALSGSGASATSDSLGSSSLGCDASRNGA
GSSDTSHTSKYFGSIDSSENNHKAKVNADAEESKHLIKYVLQDPIWLLMADTNDSVMMTY
QLPSRDLESVLKEDREKLQLLQRSQPRFTEGQRRELREVHPWVQTGGLPAAIDVAECVYC
ENEEKGNLCVLYDEDVPSMGLSDALDTKEEEKGHPVGHKEEQL
Download sequence
Identical sequences 10141.ENSCPOP00000010189 ENSCPOP00000010189 ENSCPOP00000010189

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]