SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSCPOP00000010321 from Cavia porcellus 76_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCPOP00000010321
Domain Number 1 Region: 326-381
Classification Level Classification E-value
Superfamily Endosomal sorting complex assembly domain 0.0000000000458
Family VPS37 C-terminal domain-like 0.012
Further Details:      
 
Domain Number 2 Region: 62-130
Classification Level Classification E-value
Superfamily UBC-like 0.00000000288
Family UBC-related 0.028
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCPOP00000010321   Gene: ENSCPOG00000011479   Transcript: ENSCPOT00000011585
Sequence length 397
Comment pep:known_by_projection scaffold:cavPor3:scaffold_36:3745888:3783485:1 gene:ENSCPOG00000011479 transcript:ENSCPOT00000011585 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSWLFPLTKSAASSAAGAPGGLTSLQQQKQRLIESLRNSHSSIAEIQKDVEYRLPFTVNN
LTININILLPPQFPQEKPVISVYPPIRHHLMDKQGVYVTSPLVSNFTMHSDLGKIIQSLL
DEFWKNPPVLAPTSTAFPYLYSNSSGMPPYASQCFPFVPPFPTQEANRTISSLSVADTVS
SSTTSYTTAKPAAPSFGVLSSLPLPVPMTDPSASISQNGFGYKMPDVPDAFPELSELSVS
QLTDMNEQESVLLEQFVTLPQLKQIITDKDDLVKNIEELARKNLLLEPSLEAKRQTVLDK
YELLTQMKSAFEKKMQRQHELSESCSASTLQARLKVAAHEAEEESDNIAEDFLEGKTEID
DFLSSFMEKRTICHCRRAKEEKLQQVIAMHSHFHAPL
Download sequence
Identical sequences H0VJ98
ENSCPOP00000010321 10141.ENSCPOP00000010321 XP_003469190.1.53824 ENSCPOP00000010321

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]