SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSCPOP00000010439 from Cavia porcellus 76_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCPOP00000010439
Domain Number 1 Region: 563-810
Classification Level Classification E-value
Superfamily Trypsin-like serine proteases 3.6e-82
Family Eukaryotic proteases 0.0000000518
Further Details:      
 
Domain Number 2 Region: 368-460
Classification Level Classification E-value
Superfamily Kringle-like 2.42e-38
Family Kringle modules 0.0000219
Further Details:      
 
Domain Number 3 Region: 89-182
Classification Level Classification E-value
Superfamily Kringle-like 7.73e-37
Family Kringle modules 0.000021
Further Details:      
 
Domain Number 4 Region: 272-356
Classification Level Classification E-value
Superfamily Kringle-like 5.8e-36
Family Kringle modules 0.000024
Further Details:      
 
Domain Number 5 Region: 183-266
Classification Level Classification E-value
Superfamily Kringle-like 7.73e-34
Family Kringle modules 0.0000127
Further Details:      
 
Domain Number 6 Region: 469-563
Classification Level Classification E-value
Superfamily Kringle-like 8.22e-33
Family Kringle modules 0.0000158
Further Details:      
 
Domain Number 7 Region: 18-99
Classification Level Classification E-value
Superfamily Hairpin loop containing domain-like 2.12e-20
Family Hairpin loop containing domain 0.013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCPOP00000010439   Gene: ENSCPOG00000011605   Transcript: ENSCPOT00000011717
Sequence length 812
Comment pep:novel scaffold:cavPor3:scaffold_60:9620494:9659632:1 gene:ENSCPOG00000011605 transcript:ENSCPOT00000011717 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MDHKVVILLLLFLKSGHGNSLDNYENTQGASLVSLRNKQLAATSVDECAANCEAETEFIC
RSFQYHNKKQQCVIMAENSKSSPIVRMRDVILFEKKVYLLECKTGNGKNYRGTASKTKSG
VTCQKWDATFPHKPNYFPDKHPGEGLEENYCRNPDNDQQGPWCYTTDPNKRFDYCDIPEC
EVECMHCAGENYVGKISKTESGLKCQAWDSQVPHAHGYLPSKHPNMNLKMNYCRNPDGEL
RPWCFTTDPNKRWEFCDIPRCTTPPPSSGPFYQCLKGRGENYRGKVAVTVSGRTCQRWKD
QTPHKHNRTPENYPCKDLDENYCRNPDKETAPWCYTTDSEVRWEYCAIPSCESSPSSAEH
SDGPVLPEQTPVVQECYFGNGDTYRGTSSITVSGKKCQSWSSMRPHVHNKTPEKYPDAGL
IMNYCRNPDADKSPWCYTTDPSVRWEYCNLKKCSEAGSSAVESQPPAQVPSAETTSEPDC
IVGYGKTYRGKKATTGTGTPCQRWAAQEPHKHSIFTPETNPRAALEENYCRNPDNDVNGP
WCYTMNPTKLYDYCDIPQCAPALYDCGKPRVEPKKCPGRVVGGCVANPYSWPWQISLRTR
LTMRHFCGGTLIAPEWVLTARHCLDKSLNPLYYKVILGAHQELKLESHVQAIDVARLFLG
PSGADIALLKLSSPAMITDKVIPACLPSQNYVVADRTLCYVTGWGDTQDTGTYGAGLLKE
AQLPVVENKVCNRFEYLNGRVKSNELCAGHLAGGADSCQGDSGGPLVCFEKDKYILQGVT
SWGLGCARPNKPGVYVRVSRFVNWIEETMRLN
Download sequence
Identical sequences ENSCPOP00000010439 ENSCPOP00000010439 10141.ENSCPOP00000010439

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]