SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSCPOP00000010462 from Cavia porcellus 76_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCPOP00000010462
Domain Number 1 Region: 367-477,588-736
Classification Level Classification E-value
Superfamily Periplasmic binding protein-like II 4.74e-51
Family Phosphate binding protein-like 0.0000121
Further Details:      
 
Domain Number 2 Region: 5-351
Classification Level Classification E-value
Superfamily Periplasmic binding protein-like I 3.92e-25
Family L-arabinose binding protein-like 0.0077
Further Details:      
 
Weak hits

Sequence:  ENSCPOP00000010462
Domain Number - Region: 496-581
Classification Level Classification E-value
Superfamily Voltage-gated potassium channels 0.0128
Family Voltage-gated potassium channels 0.013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCPOP00000010462   Gene: ENSCPOG00000011632   Transcript: ENSCPOT00000011744
Sequence length 932
Comment pep:known_by_projection scaffold:cavPor3:scaffold_22:32211640:32887666:-1 gene:ENSCPOG00000011632 transcript:ENSCPOT00000011744 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
FLCFLAACELMNQGILALVSSIGCTSAGSLQSLADAMHIPHLFIQRSTAGTPRSGCGLTR
SSRNEDYTLSVRPPVYLNDVILRVVTEYAWQKFIIFYDSEYDIRGIQEFLDKVSQQGMDV
ALQKVENNINKMITTLFDTMRIEELNRYRDTLRRAILIMNPATAKSFISEVVETNLVAFD
CHWIIINEEINDVDVQELVRRSIGRLTIIRQTFPVPQNTSQRCFRGNHRISSTLCDPKNP
FAQNMEISNLYIYDTVLLLANAFHKKLEDRKWHSMASLSCIRKNSKPWQGGRSMLETIKK
GGVNGLTGELEFAENGGNPNVHFEILGTNYGEELGRGVRKLGCWNPITGLNGSLTDKKLE
NNMRGVVLRVVTVLEEPFVMVSENVLGKPKKYQGFSIDVLDALSNYLGFNYEIYVAPDHK
YGSPQEDGTWNGLVGELVFKRADIGISALTITPDRENVVDFTTRYMDYSVGVLLRRAEKT
MDMFACLAPFDLSLWACIAGTVLLVGLLVYLLNWLNPPRLQMGSMTSTTLYNSMWFVYGS
FVQQGGEVPYTTLATRMMMGAWWLFALIVISSYTANLAAFLTITRIESSIQSLQDLSKQT
DIPYGTVLDSAVYEHVRMKGLNPFERDSMYSQMWRMINRSNGSENNVVESQAGIQKVKFG
NYAFVWDAAVLEYVAINDPDCSFYTVGNTVADRGYGIALQHGSPYRDVFSQRILELQQSG
DMDILKHKWWPKNGQCDLYSSVDTKQKGGALDIKSFAGVFCILAAGIVLSCLIAMLETWW
NKRKGSRVPSKEDDKEIDLEHLHRRVNSLCTDDDSPHKQFSTSSIDLTPLDIDTLPTRQA
LEQISDFRNTHITTTTFIPEQIQTLSRTLSAKAASGFAFGNVPEHRTGPFRHRAPNGGFF
RSPIKTMSSIPYQPTPTLGLNLGNDPDRGTSI
Download sequence
Identical sequences 10141.ENSCPOP00000010462 ENSCPOP00000010462 ENSCPOP00000010462

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]