SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSCPOP00000010523 from Cavia porcellus 76_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCPOP00000010523
Domain Number 1 Region: 222-405
Classification Level Classification E-value
Superfamily vWA-like 0.000000000149
Family Trunk domain of Sec23/24 0.035
Further Details:      
 
Domain Number 2 Region: 710-817
Classification Level Classification E-value
Superfamily Sensory domain-like 0.00000863
Family YkuI C-terminal domain-like 0.048
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCPOP00000010523   Gene: ENSCPOG00000011700   Transcript: ENSCPOT00000011813
Sequence length 1270
Comment pep:known_by_projection scaffold:cavPor3:scaffold_2:67743674:67896411:-1 gene:ENSCPOG00000011700 transcript:ENSCPOT00000011813 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
RCAASGPWRTMARPRLGLLCLAACALLGAGAEADVSILEQARVLARQMHKLAADELGVVT
MQRIFNSFVYTEKVSNGESEVQQLAKKIREKFNRYLDVVNRNKQVVEASYTAHLTSPLTA
IQDCCTIPPTMMEFDGNFNTNVSRTISCDRLSTTVNSRAFNPGRDLNSVLADNLKSNPGI
KWQYFSSEEGIFTVFPAHKFRCKGSYEHRSRPIYVSTVRPQSKHIVVILDHGASVTDTQL
QIAKDAAQVILSAIDEHDKISVLTVADAVRTCSLDQCYKTFLSPATSETKRKMSSFVSSV
KASDSPTQHAAGFQKAFQLIRSTNNSTKLQANTDMVIIYLSAGLTSKDAPEEDKKATLQV
INEENSLLNNSVMILTYALMNDGVTGLKELAFLRDLAEQNSGKYGVPDRSALPVTKGSMM
VLNQLSNLETTVGRFYTNLANRMIDEAVFSLPFSDEMGDGLIMTVSKPCYFGNLLLGIVG
VDVNLAYILEDVTYYQDSLASYTFLIDNKGYTLMHPSLTRPYLLSEPPLHTDIIHYENIP
KFELVRQNILSLPLGSQIISVPVNSSLSWHLNKLRESGKDAYNVSYAWKMVQDTSFILCI
VVIQPEVPVRQLKNLNTVPSSKLLYHRLDLLGQPSACLHFKQLATLESPTVMLSAGSFSS
PYEHLSQPETKRMVEHYTAYLSDNTRLIANPGLKFSVRNEVMATSHVTDEWMTQMEMSSL
NTYIVRRYIATPNGVLRIYPGSLMDKAFDPTRRQWYLHAVANPGLISLTGPYLDVGGAGY
VVTISHTIHSSSTQLSSGHTVAVMGIDFTLRYFYKVLMDQLPVCNQDGGNKLRCFIMEDR
GYLVAHPTLIDPKGHAPVEQQHITHKEPLVANDILNHPNFVRKNLCNSFSDRTVQRFYKF
NTSLAGDLTNLVHGSHCSKYRLARIPGTNAFVGIVNETCDSLAFCACSMVDRLCLNCHRM
EQNECECPCECPLEVNECTGNLTNAENRNPSCEVHQEPVTYMALEPGLQDALRQCVNSRC
SQRLESGDCFGVLDCEWCVVDSDGKTHLDKSYCAPQKECFGGIVGAKSPYVDDTGAIGDE
VIALNMIKSAPVGPVAGGIMGCIMVLVLAVYAYRHQIHRRSHQHMSPLAAQEMSVRMSNL
ENDRDERDEDSHEDRGIISNTRFIAAVIERHAHSPERRRRYWGRSGTESDHGYSTMSPQE
DSENPPCNSDPLSAGVDVSNHDEDLDLDAPPQTAALLSHGFHHCHPHRPALHPGHCLQAA
VTVHTVDAEC
Download sequence
Identical sequences ENSCPOP00000010523 10141.ENSCPOP00000010523 ENSCPOP00000010523

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]