SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSCPOP00000010620 from Cavia porcellus 76_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCPOP00000010620
Domain Number 1 Region: 277-379
Classification Level Classification E-value
Superfamily PYP-like sensor domain (PAS domain) 6.12e-22
Family Hypoxia-inducible factor Hif2a, C-terminal domain 0.00042
Further Details:      
 
Domain Number 2 Region: 32-105
Classification Level Classification E-value
Superfamily HLH, helix-loop-helix DNA-binding domain 0.000000000000131
Family HLH, helix-loop-helix DNA-binding domain 0.0022
Further Details:      
 
Domain Number 3 Region: 128-188
Classification Level Classification E-value
Superfamily PYP-like sensor domain (PAS domain) 0.000000275
Family Hypoxia-inducible factor Hif2a, C-terminal domain 0.068
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCPOP00000010620   Gene: ENSCPOG00000011807   Transcript: ENSCPOT00000011922
Sequence length 837
Comment pep:known_by_projection scaffold:cavPor3:scaffold_24:25829314:25877071:-1 gene:ENSCPOG00000011807 transcript:ENSCPOT00000011922 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
VMLFTISCSKMSSIVDRDDNSIFDGLVEEDDKDKAKRVSRNKSEKKRRDQFNVLIKELGS
MLPGNARKMDKSTVLQKSIDFLRKHKEITAQSDASEIRQDWKPTFLSNEEFTQLMLEFTN
RTGFFGAIMTDGSIIYVSESVTSLLEHLPSDLVDQSIFNFIPEGEHSEFYKILSTHLLES
DSLTPEYLKSKNQLEFSCHMLRGTIDPKEPSTYEYVRFIGNFKSLNSVSTSAHNGFEGTI
QRTHRPSYEDRVCFVATVRLATPQFIKEMCTVEEPNEEFTSRHSLEWKFLFLDHRAPPII
GYLPFEVLGTSGYDYYHVDDLENLAKCHEHLMQYGKGKSCYYRFLTKGQQWIWLQTHYYI
TYHQWNSRPEFIVCTHTVVSYAEVRAERRRELGIEESLPETAADKSQDSGSDNRINTVSL
KEALERFDRSPTPSASSRSSRKSSHTAVSDPSSTPTKIPTDTSTPPRQHLPTHEKMAQRR
SSFSSQSVNSQSVGPSLTQPLMSQAANLPIPQGMSQFQFSAQLGAMQHLKDQLEQRTRMI
EANIHRQQEELRKIQEQLQMVHGQGLQMFLQQSNPGLNFGSVQLSSGNSSSIQQGQVVNM
QGQLVPANQLQSGMSAGHIGTSQHLMQQQTLQNTSTQERRQSQLSGHSQQTSLPSQTQST
LTGPLYNTMVISQPATGSMVQIPSSMSQNSTQGAAVTTFTQERQIRFSQGQQLVTKLVTA
PVACGAVMVPSTMLMGQVVTAYPTFATQQQQAQTLSVIPSVQQPSQAQLTQQPQQFLQAS
RLLHGNPSTQLILSAAFPLQQSAFPQSHHQQHQSQQPQQLGRHRTDSLPDPSKVQPQ
Download sequence
Identical sequences 10141.ENSCPOP00000010620 ENSCPOP00000010620 ENSCPOP00000010620

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]