SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSCPOP00000011065 from Cavia porcellus 76_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCPOP00000011065
Domain Number 1 Region: 129-373
Classification Level Classification E-value
Superfamily vWA-like 2.22e-85
Family Integrin A (or I) domain 0.0000000467
Further Details:      
 
Domain Number 2 Region: 371-458
Classification Level Classification E-value
Superfamily Integrin domains 7.32e-25
Family Integrin domains 0.00032
Further Details:      
 
Domain Number 3 Region: 622-705
Classification Level Classification E-value
Superfamily Integrin beta tail domain 2.48e-18
Family Integrin beta tail domain 0.0013
Further Details:      
 
Domain Number 4 Region: 22-78
Classification Level Classification E-value
Superfamily Plexin repeat 0.0000000000000382
Family Plexin repeat 0.001
Further Details:      
 
Domain Number 5 Region: 580-620
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000307
Family Integrin beta EGF-like domains 0.0016
Further Details:      
 
Domain Number 6 Region: 538-576
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000753
Family Integrin beta EGF-like domains 0.012
Further Details:      
 
Domain Number 7 Region: 80-154
Classification Level Classification E-value
Superfamily Integrin domains 0.00000732
Family Integrin domains 0.002
Further Details:      
 
Weak hits

Sequence:  ENSCPOP00000011065
Domain Number - Region: 505-538
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0103
Family Integrin beta EGF-like domains 0.026
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCPOP00000011065   Gene: ENSCPOG00000012302   Transcript: ENSCPOT00000012419
Sequence length 788
Comment pep:known_by_projection scaffold:cavPor3:scaffold_3:28471018:28540859:1 gene:ENSCPOG00000012302 transcript:ENSCPOT00000012419 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGIELLCFFFLFLGRDDHVRGGCAMEGAETCGDCLLIGPQCAWCSQENFTHPSGVSERCD
TPANLLAKGCQLTFIENPVSQVEILKNKPLSIGRQKNSSDIVQIAPQNLILKLRPGSEQT
LQVQVRQTEDYPVDLYYLMDLSASMDDDLNTIKELGSLLSKEMSKLTSNFRLGFGSFVEK
PVSPFMKTTPEEIANPCSSIPYICLPTFGFKHILPLTNDAERFNEIVKKQKISANIDTPE
GGFDAIMQAAVCKEKIGWRNDSLHLLVFVSDADSHFGMDSKLAGIVIPNDGLCHLDSKNE
YSMSTVMEYPTIGQLIDKVVQNNVLLIFAVTQEQVPLYENYAKLIPGATVGLLHKDSGNI
LQLIISAYEELRSEVELEVLGDTEGLNLSFTAVCNNGTLFPHQKKCLHMKVGETASFNVT
VSIPNCERKSRHVIIKPVGLGDTLEILVSPECSCDCQKEVEVNSSKCHNGNGSYQCGVCA
CNPGHMGPHCECGEDTLSTDSCKETPDHPSCSGRGDCYCGQCICHLSPYGNIYGPYCQCD
NFSCVRHKGLLCGDNGDCECGECVCRSGWTGEYCNCTTSTDTCISEDGTLCSGRGDCVCG
KCVCTNPGASGPTCERCPTCSDPCNSKRSCIECHLSADGQPGEECVDKCKLAGVTISKEA
DFSKDSSVSCSLQGENECLITFLISTDNEGKTIIHNISEKDCPKPPNIPMIMLGVSLAIL
LIGVVLLCIWKLLVSFHDRKEVAKFEAERSKAKWQTGTNPLYRGSTSTFKNVTYKHRDKL
KTDLSTDG
Download sequence
Identical sequences H0W6I6
ENSCPOP00000011065 10141.ENSCPOP00000011065 XP_003478725.1.53824 XP_012997891.1.53824 XP_012997892.1.53824 ENSCPOP00000011065

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]