SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSCPOP00000011204 from Cavia porcellus 76_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCPOP00000011204
Domain Number 1 Region: 66-293
Classification Level Classification E-value
Superfamily DNA-glycosylase 1.1e-65
Family Mismatch glycosylase 0.0000251
Further Details:      
 
Domain Number 2 Region: 338-476
Classification Level Classification E-value
Superfamily Nudix 1.22e-26
Family MutY C-terminal domain-like 0.00000229
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCPOP00000011204   Gene: ENSCPOG00000012452   Transcript: ENSCPOT00000012571
Sequence length 520
Comment pep:known_by_projection scaffold:cavPor3:scaffold_133:1552695:1556624:1 gene:ENSCPOG00000012452 transcript:ENSCPOT00000012571 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
QAIMRKASMARSHRKQAANQKGMEQRPHRSSQAKPPAPNGLAGQQEEEVLQASVSSYHLF
RDSVEVTAFRGNLLNWYDREKRDLPWRRQAEHEVDPDRRAYAVWVSEIMLQQTQVTTVIN
YYTRWMQSALGPQKWPTLQDLASASLEEVNQLWAGLGYYSRGRRLQEGAQKVVRELGGHM
PCTAETLQKFLPGVGRYTAGAIASIAFGQATAVVDGNVVRVLCRVRAIGADPSSSLVSQQ
LWSLAQQLVDPARPGDFNQAAMELGATVCTPQRPLCSDCPVQSLCRAYQRVTREQLLASQ
SPPGSPDIEECAPNTGQCRLCLPHTEPWNHNLGVANFPRKPSRRPPREEHCATCVLEQLR
ATGGALILLVQRPPSGLLAGLWEFPTVTVEPLEQHPSEALLQELQNWAGPLPTTCLQHLG
EVVHTFSHIKLTYQVYGLALEKWTPVTTPPGARWLTREEFHTAAISTAMKKVFRMYEAHQ
TGTCRGSKSSQASTLSSRKKPSRGQQVLDNYFQPLNSAAQ
Download sequence
Identical sequences ENSCPOP00000011204 10141.ENSCPOP00000011204 ENSCPOP00000011204

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]