SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSCPOP00000011528 from Cavia porcellus 76_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCPOP00000011528
Domain Number 1 Region: 1452-1623
Classification Level Classification E-value
Superfamily Fibronectin type III 4.34e-27
Family Fibronectin type III 0.0000153
Further Details:      
 
Domain Number 2 Region: 1907-2074
Classification Level Classification E-value
Superfamily Fibronectin type III 1.53e-26
Family Fibronectin type III 0.0000106
Further Details:      
 
Domain Number 3 Region: 909-1077
Classification Level Classification E-value
Superfamily Fibronectin type III 5.66e-26
Family Fibronectin type III 0.0005
Further Details:      
 
Domain Number 4 Region: 1635-1798
Classification Level Classification E-value
Superfamily Fibronectin type III 4.38e-24
Family Fibronectin type III 0.0000144
Further Details:      
 
Domain Number 5 Region: 1266-1439
Classification Level Classification E-value
Superfamily Fibronectin type III 2.18e-22
Family Fibronectin type III 0.00000923
Further Details:      
 
Domain Number 6 Region: 725-892
Classification Level Classification E-value
Superfamily Fibronectin type III 3.26e-22
Family Fibronectin type III 0.00082
Further Details:      
 
Domain Number 7 Region: 410-465
Classification Level Classification E-value
Superfamily Kringle-like 9.42e-21
Family Fibronectin type II module 0.0000458
Further Details:      
 
Domain Number 8 Region: 349-404
Classification Level Classification E-value
Superfamily Kringle-like 1.23e-20
Family Fibronectin type II module 0.0000781
Further Details:      
 
Domain Number 9 Region: 1812-1902
Classification Level Classification E-value
Superfamily Fibronectin type III 4.55e-19
Family Fibronectin type III 0.00000465
Further Details:      
 
Domain Number 10 Region: 1174-1263
Classification Level Classification E-value
Superfamily Fibronectin type III 7e-17
Family Fibronectin type III 0.00000315
Further Details:      
 
Domain Number 11 Region: 2341-2384
Classification Level Classification E-value
Superfamily FnI-like domain 0.000000000000017
Family Fibronectin type I module 0.0016
Further Details:      
 
Domain Number 12 Region: 559-605
Classification Level Classification E-value
Superfamily FnI-like domain 0.0000000000000209
Family Fibronectin type I module 0.0019
Further Details:      
 
Domain Number 13 Region: 517-561
Classification Level Classification E-value
Superfamily FnI-like domain 0.000000000000034
Family Fibronectin type I module 0.0047
Further Details:      
 
Domain Number 14 Region: 231-274
Classification Level Classification E-value
Superfamily FnI-like domain 0.000000000000127
Family Fibronectin type I module 0.00011
Further Details:      
 
Domain Number 15 Region: 474-513
Classification Level Classification E-value
Superfamily FnI-like domain 0.00000000000017
Family Fibronectin type I module 0.0019
Further Details:      
 
Domain Number 16 Region: 620-699
Classification Level Classification E-value
Superfamily Fibronectin type III 0.000000000000349
Family Fibronectin type III 0.00000641
Further Details:      
 
Domain Number 17 Region: 94-139
Classification Level Classification E-value
Superfamily FnI-like domain 0.000000000000389
Family Fibronectin type I module 0.0000656
Further Details:      
 
Domain Number 18 Region: 185-228
Classification Level Classification E-value
Superfamily FnI-like domain 0.000000000000628
Family Fibronectin type I module 0.00012
Further Details:      
 
Domain Number 19 Region: 2296-2339
Classification Level Classification E-value
Superfamily FnI-like domain 0.000000000000703
Family Fibronectin type I module 0.0042
Further Details:      
 
Domain Number 20 Region: 50-91
Classification Level Classification E-value
Superfamily FnI-like domain 0.00000000000249
Family Fibronectin type I module 0.00017
Further Details:      
 
Domain Number 21 Region: 140-183
Classification Level Classification E-value
Superfamily FnI-like domain 0.00000000000807
Family Fibronectin type I module 0.00022
Further Details:      
 
Domain Number 22 Region: 2384-2425
Classification Level Classification E-value
Superfamily FnI-like domain 0.0000000000366
Family Fibronectin type I module 0.0026
Further Details:      
 
Domain Number 23 Region: 308-346
Classification Level Classification E-value
Superfamily FnI-like domain 0.00000000012
Family Fibronectin type I module 0.0003
Further Details:      
 
Domain Number 24 Region: 2210-2274
Classification Level Classification E-value
Superfamily Fibronectin type III 0.00000000177
Family Fibronectin type III 0.0032
Further Details:      
 
Domain Number 25 Region: 1094-1181
Classification Level Classification E-value
Superfamily Fibronectin type III 0.00000000187
Family Fibronectin type III 0.0017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCPOP00000011528   Gene: ENSCPOG00000012808   Transcript: ENSCPOT00000012933
Sequence length 2478
Comment pep:known_by_projection scaffold:cavPor3:scaffold_13:47625770:47686396:-1 gene:ENSCPOG00000012808 transcript:ENSCPOT00000012933 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MLRGPRPGLLLLLAALCLGTAVPPVGSSKSKRQTQQIVQPQSPVAVSQSKPGCYDNGKHY
QINQQWERTYLGNALVCTCYGGSRGFNCESKPEREETCFDKYTGNTYRVGDTYERPKDSM
IWDCTCIGAGRGRISCTIANRCHEGDQSYKIGDTWRRPHESGGYMLECVCLGNGKGEWTC
KPIAEKCFDHAAGTSYVVGETWEKPYQGWMMVDCTCLGEGSGRITCTSRNRCNDQDTRTS
YRIGDTWSKKDNRGNLLQCICTGNGRGEWKCERHASLQTTATGSGGPFTDIRTAIYQPQP
HPQPAPYGHCVTDSGVVYSVGMQWLKTQGNKQMLCTCLGNGVSCQETAVTQTYGGNSNGE
PCVLPFTYNGRTFYSCTSEGRQDGHLWCSTTSNYEQDKKYSFCTDHAVLVQTRGGNSNGA
LCHFPFLYNNHNYTDCTSEGRRDNMKWCGTTQNYDADQKFGFCPMAAHEEICTTNEGVMY
RIGDQWDKQHDMGHMMRCTCVGNGRGEWTCVAYSQLRDQCIVDNITYNVNDTFHKRHEEG
HMLNCTCFGQGRGRWKCDPIDQCQDSESRTFYQIGDSWEKYVHGVRYQCYCYGRGIGEWH
CQPLQTYAGSSGPVQVIITETPSQPNSHPIQWNAPEPSHITQYVLRWRPKTSTGRWKDAT
IPGHLNSYTIKGLTPGVVYEGQLISYQQYGHREVTRFDFTTSASTPVTSNTVTGESTVPP
PVVATSESVTEITASSFVVSWVSASDTVSGFRVEYELSEEGDEPQYLDLPSTATSVNIPD
LLPGRKYIVNVYQISEEGKQSLILSTSQTTAPDAPPNPTVDRVDDTSIVVSWSRPQAPIT
GYRIVYSPSVEGSSTELNLPETADSVTLSDLQPGIQYNITIYAVEENQESAPIFIQQETT
GVPRSDKVPPPRDLQFVEVTDVKVTIMWTPPDSAVTGYRVEVLPVNLPGEHGQRLPVNRN
TFAEVTGLSPGVTYFFKVFAVNHGRESKPLTAQQTTKLDAPTNLQFTNETDTSVLVVWTP
PRAQVTGYRLTVGLTRGDQPKQYSVGPSASRYPLRNLQPGSEYTVSLVAVKGNQQSPKVT
GVFTTLQPGTSIPFYNTEVTETTIVITWTPVPRIGFKLGVRPSQGGEAPREVTSDSGSIV
VSGLTPGVEYVYSIQVLRDGQERDAPIVNTVVTPLSPPTNLHLETNPDTGVLTVSWERST
TPDITGYRITTTPTNGQQGYSLEEVVHADQSSCTFENLSPGVEYNVSVYTVKDNKESVPV
SDTIIPEVPQLTDLSFVDITDSSIGLRWTPLNSSTIIGYRITVVAAGEGIPIFEDFVDSS
VGYYTVTGLEPGIDYDISVITLINGGESAPTTLTQQTAVPPPTDLRFTNIGPDTMRVTWA
PPPSIELTNFLLRYSPVKNEEDVAELSISPSDNAVVLTNLLPGTDYLVSVSSVYEQHESI
PLRGRQKTGLDSPTGIDFSDITANSFTVHWIAPRATITGYRIRHHPEHLSGRPREDRVPP
SRNSITLTNLLPGTEYVVSIVAVNGREESPILIGQQSTISDVPRDLEVVASTPNSVMIKW
DAPGVTVRYYRITYGETGGNSPVQEFTVPGTKNTATISNLKPGADYTITLYAVTGRGDSP
ASSKPVSIDYRTEIDKPSQMQVTDVQDNSISVRWLPSKSPVTGYRVTTTPKNGVGPSKTK
NAGPDQTEMTIEGLQPTVEYVVSVYAQNQNGESQPLVKTAVTNIDRPKGLAFTDVDVDSI
KIAWESPQGQVTRYRVTYSSPEDGIHELFPAPDGEEDTAELQGLRPGSEYTVSVVALHGD
MESKPLIGTQCTAIPAPTDLRFTQVTPTSLSAEWTAPNVRLTGYRVRVTPKEKTGPMKEI
NLSPDSSSVVVSGLMVATKYEVSVYALKDTLTSRPAQGVVTTLENVSPPRRARVTDATET
TITISWRTKTETITGFQVDAVPASGQTPVQRTISPDVRSYTITGLQPGTDYKIYLYTLNS
NARSSPVVIDASTAIDAPSNLRFLTTTPNSLLVSWQPPRARITGYIIKYEKPGSTPREVL
PRPRPGVTEATITGLEPGTEYIIYVIALKNNQKSEPLIGRKKTDELPQLVTLPHPNHHGP
EILDVPSTVHQTPFVTNPGYATGNGIQLPGTSLQQPSVGQQMIFEEHGFRRTTPPTAATP
VRHRPRPYPPNVDEEIQIGHVPRGDVDHHLYPHVLGLNPNASTGQEALSQTTISWTPFQE
SSEYIISCHPVGVDEDLLQFRVPGTSTSATLTGLTRGATYNIIVEALKDQKRHKVQEEVV
TVGNSVNEGLNQPTDDSCFDPYTVSHYAIGDEWERLSESGFKLTCQCLGFGSGHFRCDSS
KWCHDNGVNYKIGEKWDRQGENGQMMSCTCLGNGKGEFKCDPHEATCYDDGKMYHVGEQW
QKEYLGAICTCSCFGGQRGWRCDTCRRPGAEPGPEGSAGHAYGPYTQRYHQRTNTNVNCP
IECFMPLDVQADREDSRE
Download sequence
Identical sequences H0VMA2
ENSCPOP00000011528 XP_003474253.1.53824 ENSCPOP00000011528 10141.ENSCPOP00000011528

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]