SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSCPOP00000011702 from Cavia porcellus 76_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCPOP00000011702
Domain Number 1 Region: 327-429
Classification Level Classification E-value
Superfamily PYP-like sensor domain (PAS domain) 2.23e-28
Family Hypoxia-inducible factor Hif2a, C-terminal domain 0.0027
Further Details:      
 
Domain Number 2 Region: 56-139
Classification Level Classification E-value
Superfamily HLH, helix-loop-helix DNA-binding domain 0.00000000000000262
Family HLH, helix-loop-helix DNA-binding domain 0.0022
Further Details:      
 
Domain Number 3 Region: 138-192,219-234,262-274
Classification Level Classification E-value
Superfamily PYP-like sensor domain (PAS domain) 0.0000000000000154
Family BphP N-terminal domain-like 0.064
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCPOP00000011702   Gene: ENSCPOG00000012997   Transcript: ENSCPOT00000013123
Sequence length 708
Comment pep:known_by_projection scaffold:cavPor3:scaffold_10:30143705:30245329:1 gene:ENSCPOG00000012997 transcript:ENSCPOT00000013123 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
PEMASDIPGSVTLPVAPMAASGQVRMAGAMPARGGKRRSGMDFDDEDGEGPSKFSRENHS
EIERRRRNKMTQYITELSDMVPTCSALARKPDKLTILRMAVSHMKSMRGTGNKSTDGAYK
PSFLTEQELKHLILEAADGFLFVVAAETGRVIYVSDSVTPVLNQPQSEWFGSTLYEQVHP
DDVEKLREQLCTSENSMTGRILDLKTGTVKKEGQQSSMRMCMGSRRSFICRMRCGNAPLD
HLPLNRITTMRKRFRNGLGPVKEGEAQYAVVHCTGYIKAWPPAGMTIPEEDADVGQGSKY
CLVAIGRLQVTSSPVCMDMNGMSVPTEFLSRHNSDGIITFVDPRCISVIGYQPQDLLGKD
ILEFCHPEDQSHLRESFQQVVKLKGQVLSVMYRFRTKNREWVLIRTSSFTFQNPYSDEIE
YIICTNTNVKQLQQQQAELEVHQRDGLSSYDLSQVPVPNLPAGVHEAGKSVEKADSIFSQ
ERDPRFAEMFAGISASEKKMISSASAAGAQQIYSQGSPFPPGHSGKAFSSSVVHVPGVND
IQSSSSTGQNMSQISRQLSQSQAAWTGSRPPFPGQQIPSQSSKTQSSPFGIGTSHTYPAD
PASYSPLSSPATSSPSGNAYSSLANRTPGFAESGQSSGQFQGRPSEVWSQWQSQHHGQQS
GEQHPHQQPGQTEVFQDMLPMPGDPTQGTGNYNIEDFADLGMFPPFSE
Download sequence
Identical sequences 10141.ENSCPOP00000011702 ENSCPOP00000011702 ENSCPOP00000011702

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]