SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSCPOP00000011810 from Cavia porcellus 76_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCPOP00000011810
Domain Number 1 Region: 24-499
Classification Level Classification E-value
Superfamily ALDH-like 2.62e-137
Family ALDH-like 0.00000122
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCPOP00000011810   Gene: ENSCPOG00000013120   Transcript: ENSCPOT00000013247
Sequence length 511
Comment pep:known_by_projection scaffold:cavPor3:scaffold_6:17231705:17263534:1 gene:ENSCPOG00000013120 transcript:ENSCPOT00000013247 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSTLLIQKPQYAWLKELGLREENEGVYNGSWGGRGEVITTYCPFNNEPIARVRQASVADY
EETVKKAKEAWKIWADVPAPKRGEIVRQIGDALREKIQVLGNLVSLEMGKILAESVGEIQ
EYVDICDYAVGLSRMIGGPILPSERPGHVLIEQWNPVGLVGIITAFNFPVAVYGWNNAIA
LVAGNVCLWKGAPTTSLISVAVTKIVAKVLEENKLPGAICSLACGGADIGTAMAKDERVN
LLSFTGSTQVGKQVALMVQERFGKCLLELGGNNAIIVFEDADLNLVVPSALFAAVGTAGQ
RCTTARRLFLHESIHDEVISKLKKAYAQIRVGDPLEPNVLYGPLHSKQSVSKFLGAVEEA
KKGGGTVVCGGKVMDRPGNYVEPTIVTGLMHDAPIVHTETFAPILYVIKFKNEEEAFAWN
NEVKQGLSSSIFTKDLGRIFRWLGPKGSDCGVVNVNIPTNGAEIGGAFGGEKHTGGGRES
GSDAWKQYMRRSTCTINYSKDLPLAQGLKFE
Download sequence
Identical sequences ENSCPOP00000011810 10141.ENSCPOP00000011810 ENSCPOP00000011810

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]