SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSCPOP00000011890 from Cavia porcellus 76_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCPOP00000011890
Domain Number 1 Region: 122-271
Classification Level Classification E-value
Superfamily Mannose 6-phosphate receptor domain 7.06e-42
Family Mannose 6-phosphate receptor domain 0.000000128
Further Details:      
 
Domain Number 2 Region: 275-419
Classification Level Classification E-value
Superfamily Mannose 6-phosphate receptor domain 1.83e-41
Family Mannose 6-phosphate receptor domain 0.000000396
Further Details:      
 
Domain Number 3 Region: 579-714
Classification Level Classification E-value
Superfamily Mannose 6-phosphate receptor domain 2.09e-40
Family Mannose 6-phosphate receptor domain 0.00034
Further Details:      
 
Domain Number 4 Region: 1466-1597
Classification Level Classification E-value
Superfamily Mannose 6-phosphate receptor domain 3.53e-36
Family Mannose 6-phosphate receptor domain 0.000000242
Further Details:      
 
Domain Number 5 Region: 711-876
Classification Level Classification E-value
Superfamily Mannose 6-phosphate receptor domain 7.33e-35
Family Mannose 6-phosphate receptor domain 0.0016
Further Details:      
 
Domain Number 6 Region: 1317-1457
Classification Level Classification E-value
Superfamily Mannose 6-phosphate receptor domain 1.22e-34
Family Mannose 6-phosphate receptor domain 0.00068
Further Details:      
 
Domain Number 7 Region: 1174-1313
Classification Level Classification E-value
Superfamily Mannose 6-phosphate receptor domain 1.96e-32
Family Mannose 6-phosphate receptor domain 0.00013
Further Details:      
 
Domain Number 8 Region: 430-570
Classification Level Classification E-value
Superfamily Mannose 6-phosphate receptor domain 2.22e-32
Family Mannose 6-phosphate receptor domain 0.0015
Further Details:      
 
Domain Number 9 Region: 1020-1169
Classification Level Classification E-value
Superfamily Mannose 6-phosphate receptor domain 2.35e-32
Family Mannose 6-phosphate receptor domain 0.00084
Further Details:      
 
Domain Number 10 Region: 1937-2076
Classification Level Classification E-value
Superfamily Mannose 6-phosphate receptor domain 2.35e-30
Family Mannose 6-phosphate receptor domain 0.0014
Further Details:      
 
Domain Number 11 Region: 1-119
Classification Level Classification E-value
Superfamily Mannose 6-phosphate receptor domain 1.83e-29
Family Mannose 6-phosphate receptor domain 0.00000131
Further Details:      
 
Domain Number 12 Region: 1602-1747
Classification Level Classification E-value
Superfamily Mannose 6-phosphate receptor domain 4.84e-29
Family Mannose 6-phosphate receptor domain 0.001
Further Details:      
 
Domain Number 13 Region: 2083-2230
Classification Level Classification E-value
Superfamily Mannose 6-phosphate receptor domain 1.7e-28
Family Mannose 6-phosphate receptor domain 0.001
Further Details:      
 
Domain Number 14 Region: 1754-1847,1896-1939
Classification Level Classification E-value
Superfamily Mannose 6-phosphate receptor domain 9.68e-23
Family Mannose 6-phosphate receptor domain 0.0036
Further Details:      
 
Domain Number 15 Region: 886-1028
Classification Level Classification E-value
Superfamily Mannose 6-phosphate receptor domain 6.02e-20
Family Mannose 6-phosphate receptor domain 0.0033
Further Details:      
 
Domain Number 16 Region: 1846-1894
Classification Level Classification E-value
Superfamily Kringle-like 7.14e-16
Family Fibronectin type II module 0.0012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCPOP00000011890   Gene: ENSCPOG00000013207   Transcript: ENSCPOT00000013334
Sequence length 2439
Comment pep:known_by_projection scaffold:cavPor3:scaffold_60:10047971:10136270:-1 gene:ENSCPOG00000013207 transcript:ENSCPOT00000013334 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
LSSYTWEAVDTKSNKLYKISVCGNVDESHCGTSSAVCMHDLKTNSFQSVGDSLLKNAARS
LLEFNTTTNCGQQPAEHKVQSSITFLCGKTLGTPEFVTSTECVHYFEWRTTAACKKDTFK
ANKEVPCYVFDAELKKHDLNPLIKVSGGYLVDDSDPDTSLFINVCRDIDSLRDLSPQLRA
CPVGTAACLLRGNQAFDVGQPKEGLKLASKDRLVLTYVKEGVGKPDFCDGHSPAVTITFV
CPSERREGTLPKLTAKSNCRYEVEWITEYACHRDYLESSTCTLSSGQHDIAIDLRPLNML
GGSYTSDGKEYIFYLNVCGEAKSVACNNKKEAAVCQVKKSDNTQVKIAGRPQNQTLRYSD
GDLTLIYFGGEECSSGFQRMSVINFECNETARNGGKGEPVFTGEVDCTYFFTWDTKYACV
KEKEDLLCGVSDGRKRYDLSALARHSESEQNWEAVDGSQTEAEKKHFFINVCHRVLREGK
AINCSEDAAVCAVDKTGSKSLGKFTSSPTKEEGNIQLSYSDGDDCGGNKKIKTIITLICK
PGDLASAPVLRTSGDNGCFYEFEWHTAAACVLSKTEGDNCTVFDSQAGFSFDLSPLTKKN
GAYKVETEKYEFYINVCGSVSMQTCPSDSGACQISKSDRKFWNLGLSNGKLSYYDGMIQL
SYKDGTPYNNEKHTPRSTLITFLCDRDAGVGLPEYQEEDNSTYNFRWYTSYACPEEPLEC
VVTDPSTLEQYDLSSLAKFEGSPGRNWYAMDNLGEHITWKKYYINVCRPLNPVPGCDRYA
SACQMKYENSQGTFTETVAISSLGVAKTGPVVEESGSLLLEYVNGSACTTSDGRVTTYST
RLHLVCSPGSLNTHPVFSLNWDCVVSFLWNTEAACPIQTVTDTDQACSVRDPNSGFMFNL
NPLSNPQGYLVSGIGKTFLLNICGTMSACGTVAGKLASGCEATETQELKNVRAEKPVGFK
KRLQLSTEGFLTLTYTGFPPADKGTAFIIRFICNDDIYPGAIKFLHQDIDSAQGIRNTFF
EFETALACIPSPVDCQVTDSAGNEYDLSALSAVKKPWTAVDTTADRKKRTFYLSVCSPLP
FVTGCHGSAVGSCVVSEESSWNLGVVQISPQAAANGSLSIVYVNGDKCGNQRYSTRIMFE
CAQTSGSPMFQLQNNCEYVFLWRTVEACPVVRAEGDNCQVKDPRHGTLYDLRPLGLSDTI
VSFAEYTYYFRVCGQLSSNVCGIQDRSKIVSACQEKKGEQKFEKVAGLLTQKLTYENGLL
KMNYTGGDTCHRVYQRSTTIFFYCDRSTQKPVFLRETSDCSYLFEWRTQYACPPFNVTEC
SFNDGAGNSFDLSSLSRYSDNWEAVTRTGATEHFLINVCKSLAPQTGSETCHPESAVCLL
DGSKSVNLGRVRDGPQRIDGVTVLTYVDGDLCPDKIRRKSTTIRFSCSESQVNSRPLFIS
AVEDCEYTFSWPTAAACPVQKTVHDDCQVTNPSTGHLFDLSSLSSRAGFTAAYSENGLVY
MSICGENENCAPGMGACFGQTRISVGKASKKLSYEDQVLQLVYEDGSSCPSKSGLRYKSV
ISFVCRPEAGPTSRPVLISLDKQTCTLFFSWHTPLACEQATECTVRNGSSIIDLSPLIHR
TGGYEAYDESEEDTSDTNPDFYINICQPLNPMHGVPCPAGAAVCKIPVTGPPLDIGRVTG
PPRLSAGGTEVYLTLESRTPCLADKQFNYTSLITFHCKRGVSMGTPKLIRTTGCDFVFEW
QTPVVCPDEVKMEGCALTDEQLLYSFNLTSLSKGPFKVTRDSHTYSVGVCTAAAGLDQGG
CKDGGVCLLSGSKGVSFGRLASMQLDYRHEDEAVILSYVNGDICPPETEVGDPCVFPFIF
NGRSYDDCVLEGRTKLWCSKTANYDRDHEWGFCRQSNSHRTSTITFKCDEDVTIGRPEVF
SEVRGCEVAFEWRTKVVCPPEKMECKFIQNHKTYDLRLLSSLTGSWVFMHEGASYFINLC
QRVYKGPLDCSERASICKKSASGQVQVLGLVHTQKLDVLDDKVIVTYSKGYPCGENKTAS
SVIELTCAKTVGKPAFKRFDIDSCTYYFHWDSRAACAVRPQEVQMVNGTLTNPMNGKSFS
LGDIYFKLFSASGDMRTNGDSYMYEIQLSSITSSSIPACFGANICQRKLNDEHFIRKVGT
SERTKYYVQDGDLDVVFASSSKCGKDKTKSVSSTIFFHCDPLVKEGIPEFSHETADCQYL
FSWYTSAVCPLGMGFEESIQSHKGLSERSQAVGAILSLLLVALTGCLLALLLYKKERREV
VINKLTNCCRRSSNVSYKYSKVNKEEEADENETEWLMEEIQMPPPRLVKEGQENGHITTK
SVKAEALTSLHGDDQDSEDEVLTIPEVKVHSSRGARVDNSHPVRNPQQQTHWEREDDKAG
LVPGEKTRKGKPRPGQQKTVTSTKLVSFHDDSDEDLLHI
Download sequence
Identical sequences ENSCPOP00000011890 ENSCPOP00000011890 10141.ENSCPOP00000011890

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]