SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSCPOP00000012009 from Cavia porcellus 76_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCPOP00000012009
Domain Number 1 Region: 215-642,675-751
Classification Level Classification E-value
Superfamily PFL-like glycyl radical enzymes 4.88e-197
Family R1 subunit of ribonucleotide reductase, C-terminal domain 0.00000168
Further Details:      
 
Domain Number 2 Region: 6-214
Classification Level Classification E-value
Superfamily R1 subunit of ribonucleotide reductase, N-terminal domain 4.97e-70
Family R1 subunit of ribonucleotide reductase, N-terminal domain 0.0005
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCPOP00000012009   Gene: ENSCPOG00000013340   Transcript: ENSCPOT00000013470
Sequence length 792
Comment pep:known_by_projection scaffold:cavPor3:scaffold_103:3922196:3962076:1 gene:ENSCPOG00000013340 transcript:ENSCPOT00000013470 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MHVIKRDGRQERVMFDKITSRIQKLCYGLNMDFVDPAQITMKVIQGLYSGVTTVELDTLA
AETAATLTTKHPDYAILAARIAVSNLHKETKKVFSDVMEDLFNYINPHNGKHSPMVAKST
LDIVLANKDRLNSAIIYDRDFSYNYFGFKTLERSYLLKINGKVAERPQHMLMRVSVGIHK
EDIDAAIETYNLLSERWFTHASPTLFNAGTNRPQLSSCFLLSMKDDSIEGIYDTLKQCAL
ISKSAGGIGVAVSCIRATGSYIAGTNGNSNGLVPMLRVYNNTARYVDQGGNKRPGAFAIY
LEPWHLDIFEFLDLKKNTGKEEQRARDLFFALWIPDLFMKRVETNQDWSLMCPNECPGLD
EVWGEEFEKLYERYEKQGRVRKVVKAQQLWYAIIESQTETGTPYMLYKDSCNRKSNQQNL
GTIKCSNLCTEIVEYTSKDEVAVCNLASLALNMYVTSEHTYDFKKLAEVTKVIVRNLNKI
IDINYYPVPEAHLSNKRHRPIGIGVQGLADAFILMRYPFESPEAQLLNKQIFETIYYGAL
EASCDLAKEHGPYETYEGSPVSKGILQYDMWNVTPTDLWDWKLLKEKIAKYGVRNSLLIA
PMPTASTAQILGNNESIEPYTSNIYTRRVLSGEFQIVNPHLLKDLTERGLWNEKMKNQII
ACNGSIQTILEIPDDLKQLYKTVWEISQKTVLKMAADRGAFIDQSQSLNIHIAEPNYGKL
TSMHFYGWKQGLKTGMYYLRTRPAANPIQFTLNKEKLKDKEKASKEEEEKERNTAAMVCS
LENRDECLMCGS
Download sequence
Identical sequences A0A286X924
10141.ENSCPOP00000012009 ENSCPOP00000012009 ENSCPOP00000012009 XP_003463430.1.53824

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]