SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSCPOP00000012030 from Cavia porcellus 76_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCPOP00000012030
Domain Number 1 Region: 33-516
Classification Level Classification E-value
Superfamily ALDH-like 1.83e-184
Family ALDH-like 0.0000000000000241
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCPOP00000012030   Gene: ENSCPOG00000013363   Transcript: ENSCPOT00000013494
Sequence length 521
Comment pep:novel scaffold:cavPor3:scaffold_115:3032722:3062306:1 gene:ENSCPOG00000013363 transcript:ENSCPOT00000013494 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MLRAAALAASGLGPRLGRRLLSAAAAQAVPTPNQQPEVFYNQIFINNEWHDAVSKKTFPT
VNPSTGEVICQVAEGNKEDVDKAVKAARAAFQLGSPWRRMDASERGRLLNRLADLIERDR
TYLAALETLDNGKPYVISYLVDLDMVLKCIRYYAGWADKYHGKTIPIDGDFFSYTRHEPV
GVCGQIIPWNFPLLMQAWKLGPALATGNVVVMKVAEQTPLTALYVANLIKEAGFPPGVVN
IVPGYGPTAGAAIASHEDVDKVAFTGSTEVGHLIQVAAGSSNLKRVTLELGGKSPNIIMS
DADMDWAVEQAHFALFFNQGQCCCAGSRTFVQESVYEEFVERSIARAKARVVGNPFDSRT
EQGPQVDETQFKKILGYIKSGKEEGAKLLCGGGAAADRGYFIQPTVFGDVQDGMTIAKEE
IFGPVMQILKFKTIEEVVGRANNTKYGLAAAVFTKDLDKANYLSQALQAGTVWVNCYDVF
GAQSPFGGYKMSGSGRELGEYGLQAYTEVKTVTVKVPQKNS
Download sequence
Identical sequences A0A286XPF7
10141.ENSCPOP00000012030 ENSCPOP00000012030 XP_003462990.1.53824 ENSCPOP00000012030

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]