SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSCPOP00000012106 from Cavia porcellus 76_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCPOP00000012106
Domain Number 1 Region: 133-247
Classification Level Classification E-value
Superfamily C-type lectin-like 1.29e-28
Family C-type lectin domain 0.00000422
Further Details:      
 
Domain Number 2 Region: 103-128
Classification Level Classification E-value
Superfamily Triple coiled coil domain of C-type lectins 0.00000262
Family Triple coiled coil domain of C-type lectins 0.0021
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCPOP00000012106   Gene: ENSCPOG00000013445   Transcript: ENSCPOT00000013577
Sequence length 247
Comment pep:known scaffold:cavPor3:scaffold_62:10601705:10604975:1 gene:ENSCPOG00000013445 transcript:ENSCPOT00000013577 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MWCSLALILILVTVSGIMCNRTDFCVGSPGIPGTPGSHGLPGRDGRDGVKGDPGPPGPMG
PPGVMPGFPGCNGMNGIPGAPGERGDKGDPGERGPPGLPASLDEEIQTIFHNLKHKILQL
TGVLSLQGSMLAVGDKVFATNGQSVDFNAIKETCARAGGDVAAPRNSEENTAISSIVKKY
NIYSYLGLTEGHTPGDFHYLDGSPLNYTNWYPGEPRGRGKEKCAEMYLDGTWNDKNCLQS
RLTICEF
Download sequence
Identical sequences P50403
ENSCPOP00000012106 10141.ENSCPOP00000012106 NP_001166485.1.53824 ENSCPOP00000012106

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]