SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSCPOP00000012192 from Cavia porcellus 76_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCPOP00000012192
Domain Number 1 Region: 314-422,544-660
Classification Level Classification E-value
Superfamily Periplasmic binding protein-like II 3.48e-55
Family Phosphate binding protein-like 0.00000000778
Further Details:      
 
Domain Number 2 Region: 5-254
Classification Level Classification E-value
Superfamily Periplasmic binding protein-like I 7.85e-19
Family L-arabinose binding protein-like 0.012
Further Details:      
 
Weak hits

Sequence:  ENSCPOP00000012192
Domain Number - Region: 485-517
Classification Level Classification E-value
Superfamily Voltage-gated potassium channels 0.0683
Family Voltage-gated potassium channels 0.023
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCPOP00000012192   Gene: ENSCPOG00000013542   Transcript: ENSCPOT00000013677
Sequence length 1316
Comment pep:known_by_projection scaffold:cavPor3:scaffold_4:28950790:29117995:-1 gene:ENSCPOG00000013542 transcript:ENSCPOT00000013677 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
QDPTSTFFQFGASIQQQATVMLKIMQDYDWHVFSLVTTIFPGYRDFISFIKTTVDNSFVG
WDMQNVITLDTSFEDAKTQVQLKKIHSSVILLYCSKDEAVLILSEARSLGLTGYDFFWIV
PSLVSGNTELIPKEFPSGLISVSYDDWDYSLEARVRDGLGILTTAASSMLEKYSYIPEAK
ASCYGQTEKPEAPLHTLHQFMVNVTWDGKDLSFTEEGYQVHPRLVVIVLNKDREWEKVGK
WENQTLSLRHAVWPRYKSFSDCEPDDNHLSIVTLEEAPFVIVEDIDPLTETCVRNTVPCR
KFVKINNSTNEGMNVKKCCKGFCIDILKKLSRTVKFTYDLYLVTNGKHGKKVNNVWNGMI
GEVVYQRAVMAVGSLTINEERSEVVDFSVPFVETGISVMVSRSNGTVSPSAFLEPFSASV
WVMMFVMLLIVSAIAVFVFEYFSPVGYNRNLAKGKAPHGPSFTIGKAIWLLWGLVFNNSV
PVQNPKGTTSKIMVSVWAFFAVIFLASYTANLAAFMIQEEFVDQVTGLSDKKFQRPHDYS
PPFRFGTVPNGSTERNIRNNYPYMHQYMTRFNQKGVEDALVSLKTGKLDAFIYDAAVLNY
KAGRDEGCKLVTIGSGYIFATTGYGIALQKGSPWKRQIDLALLQFVGDGEMEELETLWLT
GICHNEKNEVMSSQLDIDNMAGVFYMLAAAMALSLITFIWEHLFYWKLRFCFTGVCSDRP
GLLFSISRGIYSCIHGVHIEEKKKSPDFNLTGSQSNMLKLLRSANSSRMDSPKRTADFIQ
RGSLIMDMVSDKGNMIYADNRSFQGKDSIFGDNMNELQTFVANRHKDNLNNYVFQGQHPL
TLNESNPNTVEVTVSTESKGNSRPRQLWKKSMESLRQDSLSQNPVSQRDEGTVENRTHSL
KSPRYLPEEVAHSDISETSSRATCHREPDNNKNHKTKDNFKRSMASKYPKDCSEVERTYL
KTKASSPRDKIYTIDGEKEPSFHLDPPQFVENISLQENVGFPDPYQDHGENFRKGDSTLP
VNRNPLHNEDGLPNNDQYKLYAKHFTLKDKGSPHSEGSYRQNSTHCRSCLSNLPTYSGHF
TMRSPFKCDACLRMGNLYDIDEDQMLQETGNPASQEGIYQQDWAQNNTLQFQKNKLRISR
QHSYDNILDKPREIDLSKPSRSISLKDRERLLEGNLYGSLFSVPASKLSGNKSSLFPQGL
EDSKRSKSLLPDHTSDNPFLHSYRDDQRLVIGRCPSDPYKHSLPSQAVNDSYLRSSLRST
ASYCSRDSRGHSDVYISEHVMPYAANKNNMYSTPRVLNSCSNRRVYKKMPSIESDV
Download sequence
Identical sequences ENSCPOP00000012192 10141.ENSCPOP00000012192 ENSCPOP00000012192

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]