SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSCPOP00000012215 from Cavia porcellus 76_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCPOP00000012215
Domain Number 1 Region: 280-408
Classification Level Classification E-value
Superfamily ApaG-like 7.32e-41
Family ApaG-like 0.00021
Further Details:      
 
Domain Number 2 Region: 99-265
Classification Level Classification E-value
Superfamily SMI1/KNR4-like 1.57e-21
Family SMI1/KNR4-like 0.0079
Further Details:      
 
Domain Number 3 Region: 4-81
Classification Level Classification E-value
Superfamily F-box domain 1.18e-18
Family F-box domain 0.0039
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCPOP00000012215   Gene: ENSCPOG00000013568   Transcript: ENSCPOT00000013703
Sequence length 415
Comment pep:known_by_projection scaffold:cavPor3:scaffold_92:5004217:5025988:1 gene:ENSCPOG00000013568 transcript:ENSCPOT00000013703 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAAMEAESAMMTLESLPTDPLLLILSFLDYRDLINCCYVSRRLSQLSSHDPLWRRHCKKY
WLISEEEKTQKNQCWKSLFIDTYSDVGRYIDHYAAIKKAWDDLKKYLEPRCPRMVLSLKE
GAREEDLDAVEAQIGCKLPDDYRCSYRIHNGQKLVVPGLLGSMALSNHYRSEDLLDVDTA
AGGFQQRQGLKYCLPLTFCIHTGLSQYIAVEAAEGRNKNEVFYQCPDQMARDPAAIDMFI
IGATFTDWFTSYVRNVVSGGFPIIRDQIFRYVHDPECVATTGDITVSVSTSFLPELSSVH
PPHYFFTYRIRIEMSKDALPEKACQLDSRYWRITNAKGDVEEVQGPGVVGEFPIISPGRV
YEYTSCTTFSTTSGYMEGYYTFHFLYFKDKIFNVAIPRFHMACPTFRVSIARLVS
Download sequence
Identical sequences H0VP13
ENSCPOP00000012215 XP_003463892.1.53824 10141.ENSCPOP00000012215 ENSCPOP00000012215

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]