SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSCPOP00000012270 from Cavia porcellus 76_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCPOP00000012270
Domain Number 1 Region: 484-562,778-980
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 1.3e-62
Family Protein kinases, catalytic subunit 0.00066
Further Details:      
 
Domain Number 2 Region: 3-253
Classification Level Classification E-value
Superfamily Quinoprotein alcohol dehydrogenase-like 5.1e-18
Family Quinoprotein alcohol dehydrogenase-like 0.0046
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCPOP00000012270   Gene: ENSCPOG00000013630   Transcript: ENSCPOT00000013766
Sequence length 1011
Comment pep:known_by_projection scaffold:cavPor3:scaffold_37:3574017:3621737:1 gene:ENSCPOG00000013630 transcript:ENSCPOT00000013766 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
RSLVIISTLDGRISALDAENHGKKQWDLDVGSGSLVSSSLSKPEVFGNKMIIPSLDGDLF
QWDRDRESMETVPFTVESLLESSYKFGDDVVLVGGKSLTTYGLSAYSGKVRYICSALGCR
RWDSDDLEEGEDILLLQRTQKTVRAVGPRSGSEKWNFSVGHFELRYIPDLETRSRFIEST
FKPSANKEESKVISDVEEQEATMLDTVIKVSVADWKVMAFSKKGGHLEWEYQFCTPIASA
WLLRDGKVIPISLFDDTSYASNEEVLEDEEDIVEAARGATENSVYLGMYRGQLYLQSSVR
ISEKFPTSPKALESSENAIIPLPTIKWKPLIHSPSRTPVLVGSDEFDKCLSNDKFSHEEY
SNGALSILQYPYDNGYYLPYYKRERSKRSTQITVRFFDNPSYNKNIRKKDPVLLLHWWKE
IVGTILFCIVATTFIVRRLFRPQPHRQRKESETQCQTESKYDSVSGEASDSGAADVKSSG
YVSRYLTDFEPIQCMGRGGFGVVFEARNKVDDCNYAIKRIRLPNRELAREKVMREVKALA
KLEHPGIVRYFNAWLEAPPEKWQEKMDEIWLKDESTDWLLSSLSPMDAPSVKIRRVDPFS
TKEHIEVIAPLPQRSRSFSVGISCGQTSSSESQFSPLELSGMDHGDSSGSVDAANNLQDS
CLTDCDVEDGTMDSRDKGHSFELCPSEAAPYVRSRETSSSIVFEDSGCDNASSKGELKTN
RVHIGNHCANKFTAFKYSSSRSSSEATLSVSPPRPTTLSLDLSKNTTEKLQPSSPKVYLY
IQMQLCRKENLKDWMSQRCTLEERERGACLHIFLQIAEAVEFLHSKGLMHRDLKPSNIFF
TMDDVVKVGDFGLVTAMDQDEDEQTVLTPMPAYATHTGQVGTKLYMSPEQIQGNNYSHKV
DIFSLGLILFELLYPFSTQMERVRTLTDVRNLKFPVLFTQQYPREYVMVKDMLSPSPMDR
PEATNIIENSVFEDLELPGKTVLRQRSRSLSSSGTKPVRLPSSSHSVGPGG
Download sequence
Identical sequences ENSCPOP00000012270 ENSCPOP00000012270 10141.ENSCPOP00000012270

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]