SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSCPOP00000012405 from Cavia porcellus 76_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCPOP00000012405
Domain Number 1 Region: 28-116
Classification Level Classification E-value
Superfamily Ribosomal L11/L12e N-terminal domain 2.49e-34
Family Ribosomal L11/L12e N-terminal domain 0.00000649
Further Details:      
 
Domain Number 2 Region: 105-178
Classification Level Classification E-value
Superfamily Ribosomal protein L11, C-terminal domain 2.75e-18
Family Ribosomal protein L11, C-terminal domain 0.0045
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCPOP00000012405   Gene: ENSCPOG00000013769   Transcript: ENSCPOT00000013909
Sequence length 195
Comment pep:novel scaffold:cavPor3:scaffold_27:7048247:7051765:1 gene:ENSCPOG00000013769 transcript:ENSCPOT00000013909 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
AFRLSARRRQRCNFLRSSRIRVHPTPAASTMPPKFDPNEIKVVYLRCTGGEVGATSALAP
KIGPLGLSPKKVGDDIAKATGDWKGLRITVKLTIQNRQAQIEVVPSASALIIKALKEPPR
DRKKQKNIKHSGNITFDEIVNIARQMRHRSLARELSGTIKEILGTAQSVGCNVDNRHPHD
IIDDINSGAVECPAV
Download sequence
Identical sequences 10141.ENSCPOP00000012405 ENSCPOP00000012405 ENSCPOP00000012405

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]