SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSCPOP00000012420 from Cavia porcellus 76_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCPOP00000012420
Domain Number 1 Region: 2-429
Classification Level Classification E-value
Superfamily ALDH-like 1.44e-127
Family ALDH-like 0.0000000000394
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCPOP00000012420   Gene: ENSCPOG00000013785   Transcript: ENSCPOT00000013925
Sequence length 481
Comment pep:known_by_projection scaffold:cavPor3:scaffold_71:634338:658061:1 gene:ENSCPOG00000013785 transcript:ENSCPOT00000013925 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MEREVQRLRQAFRSGRSRPLQFRLQQLEALRRMVQEHEKDILAAIGADLCKSEFNGFNQE
VITVLGEIGFMLANLPEWVTPTPAKKNLLTLLDEVYVQPEPLGVVLIIGAWNYPFVLTMH
PLVGAIAAGNAAIIKPSELSENTAKILTKLLPQYLDQDLYAVINGGVEETTELLKHRFDH
ILYTGNATVGKIVMAAAAKHLTPVTLELGGKSPCYVDKDCDLDVVCRRITWGKWMNCGQT
CIAPDYVLCEASLQNQIVQKIKETVKEFYGENVKESPDYERIINLRHFKRIQSLLEGQKI
AFGGETDEATRYIAPTILTDVDPKSRVMQEEIFGPVLPLVPVKNADEAINFINEREKPLA
LYIFSHNNKLIKRMIDETSSGGVTVNDVVMHFTLNALPFGGVGASGMGAYHGKYSFDTFS
HHRACLLKSLKREGANKLRYPPNSQSKVNLAKFLLLKQFSRGKLGLLMLTFLCAVAAVFF
K
Download sequence
Identical sequences 10141.ENSCPOP00000012420 ENSCPOP00000012420 ENSCPOP00000012420

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]