SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSCPOP00000012591 from Cavia porcellus 76_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCPOP00000012591
Domain Number 1 Region: 14-477
Classification Level Classification E-value
Superfamily ALDH-like 1.31e-177
Family ALDH-like 0.000000000000185
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCPOP00000012591   Gene: ENSCPOG00000027235   Transcript: ENSCPOT00000014114
Sequence length 478
Comment pep:novel scaffold:cavPor3:scaffold_21:24161889:24188798:-1 gene:ENSCPOG00000027235 transcript:ENSCPOT00000014114 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MFPSAKIAVPAPLADLKIQYTKIFINNEWHNSVSGKKFPVINPATEEVICEVEEGDKADV
DKAVQAARQAFQIGSPWRTMDASERGRLLHKLADLIERDHLLLATMETTNAGKLFASTYL
MEIGSSVKTLRYCAGWADKIQGRTIPSDGDFFTYTRREPVGVCGQILPWNFPLVMLVWKI
GPALSCGNTVVIKPAEQTPLTALHVASLIKEAGFPPGVVNIVPGYGPTAGAAISSHMDVD
KVAFTGSTEVGKLIKEAAGKSNLKRVTLELGGKSPCIVFADADLDTAVENAHVGLFFHQG
QCCVAASRLFVEESIYDEFVRRSVERAKKYVLGNPLTPGVSQGPQIDKEQYHKILDLIES
GKKQGAKLECGGGPWGNKGYFIQPTVFSNVTDEMRIAKEEIFGPVQQIMKFKTLDEVIKR
ANNTTYGLAAGIFTKDLDKAVTVSSALQAGTVWVNCYGGGGNQCPFGGYKMSGNGREM
Download sequence
Identical sequences 10141.ENSCPOP00000012591 ENSCPOP00000012591 ENSCPOP00000012591

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]