SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSCPOP00000012604 from Cavia porcellus 76_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCPOP00000012604
Domain Number 1 Region: 230-334
Classification Level Classification E-value
Superfamily PYP-like sensor domain (PAS domain) 9.67e-26
Family Hypoxia-inducible factor Hif2a, C-terminal domain 0.0002
Further Details:      
 
Domain Number 2 Region: 88-194
Classification Level Classification E-value
Superfamily PYP-like sensor domain (PAS domain) 3.14e-16
Family Hypoxia-inducible factor Hif2a, C-terminal domain 0.046
Further Details:      
 
Domain Number 3 Region: 5-53
Classification Level Classification E-value
Superfamily HLH, helix-loop-helix DNA-binding domain 0.0000000353
Family HLH, helix-loop-helix DNA-binding domain 0.0077
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCPOP00000012604   Gene: ENSCPOG00000013987   Transcript: ENSCPOT00000014129
Sequence length 767
Comment pep:known_by_projection scaffold:cavPor3:scaffold_63:611804:680168:-1 gene:ENSCPOG00000013987 transcript:ENSCPOT00000014129 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MKEKSKNAARTRREKENSEFYELAKLLPLPSAITSQLDKASIIRLTTSYLKMRVVFPEGL
GEAWGHSSRTSPLDNVGRELGSHLLQTLDGFIFVVAPDGKIMYISETASVHLGLSQVELT
GNSIYEYIHPADHDEMTAVLTAHQPYHSHFVQEYEIERSFFLRMKCVLAKRNAGLTCGGY
KVIHCSGYLKIRQYSLDMSPFDGCYQNVGLVAVGHSLPPSAVTEIKLHSNMFMFRASLDM
KLIFLDSRVAELTGYEPQDLIEKTLYHHVHGCDTFHLRCAHHLLLVKGQVTTKYYRFLAK
HGGWVWVQSYATIVHNSRSSRPHCIVSVNYVLTDTEYKGLQLSLDQISASKPAFSYASSS
TPTMTDNRKGTKSRLSSSKSKSRTSPYPQYPGFHTERSESDHDSQWGGSPLPDAASPQLL
DPAERAGAQHDASCAYRQLSERGPLCYGFALDPSRLAEDRHFHGQACEGGRCEAGRYFLG
APQAGREPWWGSRAALPLTKASPESRDAYESGLPHIAAAVHRIHGRGHWDEDSVVSSPDP
GSASESGDRYRTDQYQSSPHEPSKIETLIRATQQMIKEEENRLQLRKAPPDQLASINGAG
KKHSLCFANYPQPPPTGEVCHSSALANTSPCDHIQQREGKMLSPHENDYDNSPTALSRIS
SPNSDRISKSSLILAKDYLHSDMSPHQTVGDHAAVSPNCFGSHRQYFDKHAYTLTGYALE
HLYDSETIRNYSLGCNGSHFDVTSHLRMQPDPAQGHKGTSVIITNGS
Download sequence
Identical sequences H0VQ06
ENSCPOP00000012604 10141.ENSCPOP00000012604 ENSCPOP00000012604 XP_003466068.1.53824

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]